Natural Citrine Infinity Pendant and Earrings Set for Women AAA - Rosec Jewels
Natural Citrine Infinity Pendant and Earrings Set for Women AAA - Rosec Jewels
Natural Citrine Infinity Pendant and Earrings Set for Women AAA - Rosec Jewels
Natural Citrine Infinity Pendant and Earrings Set for Women AAA - Rosec Jewels
Natural Citrine Infinity Pendant and Earrings Set for Women AAA - Rosec Jewels
Natural Citrine Infinity Pendant and Earrings Set for Women AAA - Rosec Jewels
Natural Citrine Infinity Pendant and Earrings Set for Women AAA - Rosec Jewels
Natural Citrine Infinity Pendant and Earrings Set for Women AAA - Rosec Jewels
Natural Citrine Infinity Pendant and Earrings Set for Women AAA - Rosec Jewels
Natural Citrine Infinity Pendant and Earrings Set for Women AAA - Rosec Jewels
Natural Citrine Infinity Pendant and Earrings Set for Women AAA - Rosec Jewels
Natural Citrine Infinity Pendant and Earrings Set for Women AAA - Rosec Jewels
Natural Citrine Infinity Pendant and Earrings Set for Women AAA - Rosec Jewels
Natural Citrine Infinity Pendant and Earrings Set for Women AAA - Rosec Jewels
Natural Citrine Infinity Pendant and Earrings Set for Women AAA - Rosec Jewels
Natural Citrine Infinity Pendant and Earrings Set for Women AAA - Rosec Jewels
Natural Citrine Infinity Pendant and Earrings Set for Women AAA - Rosec Jewels
Natural Citrine Infinity Pendant and Earrings Set for Women AAA - Rosec Jewels
Natural Citrine Infinity Pendant and Earrings Set for Women AAA - Rosec Jewels
Natural Citrine Infinity Pendant and Earrings Set for Women AAA - Rosec Jewels
13% de réduction

Ensemble pendentif et boucles d'oreilles solitaire citrine avec motif infini

£1,049.00 £1,205.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm
Qualité de la pierre
Métal
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand
Drop Hint Email Call us
Voir les détails

Détails du produit

Offrez-vous une élégance intemporelle avec cette exquise parure de bijoux Citrine Infinity, fabriquée en or pour un attrait vraiment enchanteur. L'ensemble comprend un collier pendentif en citrine bleue à couper le souffle et des boucles d'oreilles assorties, qui constituent un superbe bijou raffiné. N'hésitez pas à ajouter cet ensemble de boucles d'oreilles avec pendentif solitaire à votre collection et submergez votre être cher de son charme.

Informations sur le produit
SKU SHP-PENDANT042168474
Longueur 17,5 mm
Largeur 9,5mm
Poids 4,50 g (environ)
INFORMATIONS SUR LA CITRINE
Nombre de pierres 3 pièces
Poids total 2,22 carats (environ)
Dimension (environ) Rond-5X5 mm-2 Pièces
Rond-7X7 mm-1 Pièces
Couleur Jaune
Couper Brillant
Forme Rond
Type de paramètre Réglage à 3 broches
Niveau de qualité AAA
Voir plus

Poignée de collecte parent du produit
colliers-citrine