Unique Diamond Gothic Conch Earring for Women Natural - ( HI-SI ) - Rosec Jewels
Unique Diamond Gothic Conch Earring for Women Natural - ( HI-SI ) - Rosec Jewels
Unique Diamond Gothic Conch Earring for Women Natural - ( HI-SI ) - Rosec Jewels
Unique Diamond Gothic Conch Earring for Women Natural - ( HI-SI ) - Rosec Jewels
Unique Diamond Gothic Conch Earring for Women Natural - ( HI-SI ) - Rosec Jewels
Unique Diamond Gothic Conch Earring for Women Natural - ( HI-SI ) - Rosec Jewels
Unique Diamond Gothic Conch Earring for Women Natural - ( HI-SI ) - Rosec Jewels
Unique Diamond Gothic Conch Earring for Women Natural - ( HI-SI ) - Rosec Jewels
Unique Diamond Gothic Conch Earring for Women Natural - ( HI-SI ) - Rosec Jewels
Unique Diamond Gothic Conch Earring for Women Natural - ( HI-SI ) - Rosec Jewels
Unique Diamond Gothic Conch Earring for Women Natural - ( HI-SI ) - Rosec Jewels
Unique Diamond Gothic Conch Earring for Women Natural - ( HI-SI ) - Rosec Jewels
Unique Diamond Gothic Conch Earring for Women Natural - ( HI-SI ) - Rosec Jewels
Unique Diamond Gothic Conch Earring for Women Natural - ( HI-SI ) - Rosec Jewels
Unique Diamond Gothic Conch Earring for Women Natural - ( HI-SI ) - Rosec Jewels
Unique Diamond Gothic Conch Earring for Women Natural - ( HI-SI ) - Rosec Jewels
Unique Diamond Gothic Conch Earring for Women Natural - ( HI-SI ) - Rosec Jewels
Unique Diamond Gothic Conch Earring for Women Natural - ( HI-SI ) - Rosec Jewels
Unique Diamond Gothic Conch Earring for Women Natural - ( HI-SI ) - Rosec Jewels
Unique Diamond Gothic Conch Earring for Women Natural - ( HI-SI ) - Rosec Jewels

Boucle d'oreille conque gothique en diamant unique en or

£307.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm
Qualité de la pierre
Métal
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand
Drop Hint Email Call us
Voir les détails

Détails du produit

Cette boucle d'oreille conque gothique en diamant est ornée de diamants taille ronde fixés dans un serti griffes avec un motif de perles dorées. Vous pouvez porter cette boucle d'oreille en diamant sur votre piercing hélix, cartilage ou lobe supérieur. Offrez cette boucle d'oreille unique à votre bien-aimée comme cadeau d'anniversaire pour elle.

Informations sur le produit
SKU SHP-BODYJ082210036
Poids 0,40 g (environ)
INFORMATIONS SUR LE DIAMANT
Nombre de pierres 3 pièces
Poids total 0,06 carat (approximatif)
Dimension (environ) Rond-1,30X1,30 mm-2 Pièces
Rond-1,80X1,80 mm-1 Pièces
Couleur SALUT
Couper Brillant
Forme Rond
Type de paramètre Réglage des broches
Niveau de qualité SI
Voir plus

Poignée de collecte parent du produit
boucles d'oreilles conques