Brilliant Cut Lab Created Diamond Knot Anniversary Ring for Her

Prix habituel £259.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Celebrate love and romance with this stunning Infinity Knot Ring, perfect for any woman who appreciates meaningful jewelry. This Minimalist Ring features round shaped diamonds (lab grown) set in surface prong setting, forming an interlocked design that creates a distinctive infinity motif. The thoughtfully designed gaps between the rows add a modern flair while providing a lightweight and comfortable fit. Whether worn as a Diamond Promise Ring, an Anniversary Ring, or a chic fashion accessory, this Reverse Infinity Ring is ideal for those who adore unique designs with a striking presence. The Infinity knot symbolizes eternity, strength, and unbreakable connections - qualities that beautifully reflect the profound love and commitment you wish to express. This Lab Grown Diamond Ring is crafted with ethically sourced, lab-created stones, offering the elegance of fine jewelry while being eco-friendly. Our jewelry is packaged appropriately, ensuring it is ready for gifting upon arrival.

Product Information
SKU SHP-RINGS062510152
Width 2.2 mm
Height 6 mm
Metal Weight 2.90 gm (Approximate)
Total Stone Weight 0.31 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 62 Pieces
Total Weight 0.31 Carat (Approximate)
Dimension(approx) Round-1X1 mm-62 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Surface-Prong-Setting
Quality Grade EF-VS
View More