Diamond Clock Earring for Cartilage Piercing

Prix habituel £348.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Distinctive Timepiece Motif

The Diamond Clock Earring for Cartilage Piercing blends fine detailing with a miniature time-inspired design. Created for those who curate their ear styling with intention, this piece offers a refined yet expressive accent.

Its clock motif introduces character without overpowering surrounding jewelry, making it ideal for helix, conch, or other cartilage placements where proportion and precision matter.

Design & Setting Structure

Designed specifically for cartilage wear, the structure prioritizes secure placement and balanced weight. The compact profile supports a close fit against the ear, helping maintain comfort in elevated piercings.

The diamond detailing enhances definition within the clock-inspired silhouette, adding light reflection while preserving the clarity of the motif.

Diamond Suitability for Cartilage Wear

Diamonds are valued for their durability and brilliance, making them suitable for everyday fine jewelry, including cartilage earrings. Their hardness supports long-term wear when properly set and maintained.

High-Level Features

This cartilage earring combines a symbolic clock design with diamond accents in a compact format tailored for upper-ear piercings. It is intended for single-ear styling and curated ear combinations.

Product Information
SKU SHP-BODYJ012410089
Metal Weight 0.90 gm (Approximate)
Total Stone Weight 0.07 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 1 Pieces
Total Weight 0.07 Carat (Approximate)
Dimension(approx) Round-2.50X2.50 mm-1 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Bezel-Setting
Quality Grade SI
View More

FAQs About: Diamond Clock Earring for Cartilage Piercing

Is this earring sold as a single piece?
Cartilage earrings are commonly designed and worn as single pieces to complement curated ear styling. Please refer to the product details table for exact inclusions.
Can this clock earring be worn in a helix piercing?
The compact design makes it suitable for various cartilage placements such as helix or similar upper-ear piercings, depending on individual anatomy.
Is a diamond cartilage earring suitable for daily wear?
Diamonds are known for their strength and resistance to scratching, making them appropriate for regular wear when properly secured.
How should I clean a cartilage diamond earring?
Gentle cleaning with mild soap and water, followed by careful drying, helps maintain shine. Periodic inspection of the setting is also recommended.
Does the clock design add bulk to the ear?
The design is crafted in a compact format intended to sit neatly against the cartilage, offering detail without excessive projection.