Diamond Half Sun Tragus Earring

Prix habituel £355.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Diamond Half Sun Tragus Earring

This tragus earring features a half sun design accented with diamonds, creating a distinctive piece of jewelry designed specifically for cartilage piercings. The structured arrangement of diamonds forms a subtle sun-inspired silhouette that adds visual detail while maintaining a minimal profile.

Its compact size makes it suitable for tragus and other cartilage placements where refined and lightweight jewelry is preferred. The design focuses on subtle sparkle while complementing modern ear styling trends.

Half Sun Diamond Design

The half sun motif arranges diamonds in a curved formation that resembles a rising sun shape. This design provides a decorative structure while keeping the earring small enough for cartilage piercings.

The curved diamond arrangement introduces gentle symmetry and texture, allowing the piece to stand out while remaining understated.

Diamond Accents in Fine Jewelry

Diamonds are widely used in fine jewelry due to their brilliance and ability to reflect light through multiple facets. In small jewelry designs such as tragus earrings, diamond accents contribute subtle sparkle without overpowering the overall style.

These gemstones are commonly chosen for body jewelry where a refined appearance and durable materials are preferred.

Modern Cartilage Jewelry Style

Cartilage jewelry has become an important part of contemporary ear styling, where multiple piercings are often combined to create layered looks. Minimal designs such as tragus earrings help balance more prominent ear jewelry pieces.

The half sun structure and diamond accents allow this piece to integrate easily into curated ear arrangements while still offering a distinctive design element.

Product Information
SKU SHP-BODYJ102310053
Metal Weight 1.00 gm (Approximate)
Total Stone Weight 0.02 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 1 Pieces
Total Weight 0.02 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-1 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

FAQs About: Diamond Half Sun Tragus Earring

What is a tragus earring?
A tragus earring is designed for the small cartilage area in front of the ear canal known as the tragus.
What type of jewelry is suitable for cartilage piercings?
Cartilage piercings often use small, lightweight earrings designed specifically to fit securely while remaining comfortable for everyday wear.
Why are diamond accents used in small earrings?
Diamond accents add subtle sparkle and visual detail while maintaining a minimal jewelry design.
What does a half sun design represent in jewelry?
A half sun design features gemstones arranged in a curved pattern that resembles a rising sun shape.
Can tragus earrings be part of curated ear styling?
Yes. Tragus earrings are often combined with other cartilage and lobe jewelry to create layered ear styling.
Why choose minimal jewelry for cartilage piercings?
Minimal jewelry designs are commonly chosen for cartilage piercings because they provide subtle style while remaining comfortable and easy to wear.