Lab Diamond Infinity Heart Necklace With Certificate

Prix habituel £259.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Infinity and Heart in One Meaningful Design

This lab diamond infinity heart necklace brings together two enduring symbols—love and continuity—into a single refined pendant. The flowing infinity form gently interlocks with a heart silhouette, creating a balanced design that feels intentional rather than ornate.

Its proportions are designed to sit neatly along the neckline, making it suitable for daily wear or meaningful gifting.

Thoughtful Structure and Stone Placement

The infinity heart framework supports the lab grown diamonds in a way that highlights their brilliance while maintaining clean visual lines. The arrangement allows light to interact with the stones without overwhelming the symbolic motif.

This considered construction helps the necklace maintain both emotional significance and a polished appearance.

Certified Lab Diamond Quality

Lab grown diamonds share the same physical, chemical, and optical properties as mined diamonds, offering durability suitable for everyday jewelry. Their hardness makes them appropriate for consistent wear in pendant form.

They are created without traditional mining, though environmental impact varies by production and energy source. Certification provides documented details about the diamonds used in the necklace.

High-Level Features

This necklace features certified lab grown diamonds set within an infinity heart motif. The design focuses on symbolic elegance, balanced sparkle, and dependable craftsmanship intended for long-term wear.

Product Information
SKU SHP-PENDANT062510072
Metal Weight 3.90 gm (Approximate)
Total Stone Weight 0.23 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 28 Pieces
Total Weight 0.23 Carat (Approximate)
Dimension(approx) Round-2.50X2.50 mm-1 Pcs
Round-1.10X1.10 mm-23 Pcs
Round-1X1 mm-2 Pcs
Round-0.90X0.90 mm-2 Pcs
Color E-F
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade VS
View More

FAQs About: Lab Diamond Infinity Heart Necklace with Certificate

What does the certificate confirm for this necklace?
The certificate documents the characteristics and origin of the lab grown diamonds used in the infinity heart necklace.
Is the infinity heart design suitable for everyday wear?
The pendant format and balanced structure make it appropriate for daily wear while maintaining a refined and meaningful appearance.
Do lab grown diamonds look different from natural diamonds?
Lab grown diamonds have the same visual and structural properties as natural diamonds and are not distinguishable without specialized equipment.
Is this necklace appropriate as a gift?
The combined infinity and heart motif represents enduring affection, making it a meaningful option for anniversaries, milestones, or personal occasions.
How should the necklace be cared for?
Regular gentle cleaning and periodic inspection of the setting help preserve the brilliance of the lab diamonds and maintain the necklace’s structure.