Diamond Heart Upper Lobe Earring

Reguliere prijs £341.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Heart Motif Designed for Upper Lobe Styling

The diamond heart upper lobe earring is created for those who prefer meaningful design in a subtle scale. Its heart silhouette offers symbolic expression while remaining proportioned for upper lobe placement.

Ideal for layered ear styling, this piece complements primary studs or hoops without overpowering the overall look.

Balanced Structure with Secure Placement

The heart form is carefully structured to maintain symmetry and visual clarity. Its setting is designed to sit comfortably along the upper lobe, supporting stability throughout daily wear.

The compact architecture allows the design to remain refined while still delivering noticeable brilliance.

Light Behavior: Soft, Centered Sparkle

Diamonds reflect light with controlled brilliance, concentrating sparkle toward the center of the heart shape. This creates a gentle glow effect rather than an overwhelming shine, making it suitable for close-to-ear placements.

Diamond Durability and Daily Consideration

Diamonds are valued for their hardness and long-term resilience. With proper care and secure fastening, they are suitable for consistent wear in upper lobe piercings.

Product Information
SKU SHP-BODYJ102310035
Metal Weight 0.75 gm (Approximate)
Total Stone Weight 0.15 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 6 Pieces
Total Weight 0.15 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-6 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

FAQs About: Diamond Heart Upper Lobe Earring

Is this earring sold as a single piece?
Upper lobe earrings are typically sold as single pieces unless otherwise specified in the product details.
Is it suitable for second or third lobe piercings?
Yes, its scale and structure are suitable for second or third lobe placements when matched to your piercing size.
Can it be paired with other earrings?
This design pairs well with minimalist studs, small hoops, or primary statement earrings for a layered look.
Is it comfortable for daily wear?
When secured properly and matched to your piercing specifications, it is suitable for regular wear.
How should I clean this earring?
Clean gently with mild soap and warm water using a soft brush, then dry thoroughly before wearing again.