0.45 Carat Fire Opal Flower Engagement Ring with Diamond

Sale price £764.00 Regular price £858.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Floral Engagement Ring with Vibrant Fire Opal

The 1/2 CT Fire Opal Flower Engagement Ring with Diamond is designed for those who prefer a more expressive and colorful approach to traditional engagement jewelry. The vivid hue of the fire opal creates a striking focal point, while the floral-inspired structure adds softness and detail to the overall design.

This ring is suited for buyers who want a distinctive engagement piece that reflects individuality. Its combination of color and form makes it an appealing choice for those who value symbolic design with a more artistic and less conventional look.

Why the Flower-Inspired Design Matters

Floral-inspired rings are often chosen for their symbolic connection to growth, beauty, and natural elegance. In this design, the arrangement of elements around the center stone creates a petal-like effect, giving the ring a structured yet delicate appearance.

The use of diamond accents enhances the floral motif by adding brightness and contrast around the center gemstone. This interplay between the opal and surrounding stones helps define the shape while maintaining a balanced and cohesive design.

The Appeal of Fire Opal with Diamond

Fire opal is valued for its warm, vibrant color that ranges from bright orange to reddish tones. Its distinctive appearance makes it a strong alternative to more traditional engagement stones, offering a bold and recognizable look.

When paired with diamond accents, the fire opal gains additional visual depth. The diamonds introduce light reflection that complements the opal’s color, creating contrast while keeping the center stone as the primary focus.

High-Level Features Buyers Appreciate

This ring combines a colorful center stone with a structured floral design, creating a piece that feels both decorative and meaningful. The balanced composition allows the ring to stand out while remaining wearable for various occasions.

Its distinctive look makes it suitable for those seeking an engagement ring that reflects personality and style. The blend of gemstone color and delicate detailing offers a design that feels unique without compromising on elegance.

Product Information
SKU SHP-RINGS0821183102
Width 5.4 mm
Height 8 mm
Weight 2.40 gm (Approximate)
FIRE OPAL INFORMATION
No.of Stones 1 Pieces
Total Weight 0.45 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Orange
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 18 Pieces
Total Weight 0.22 Carat (Approximate)
Dimension(approx) Round-1.40X1.40 mm-18 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
fire-opal-engagement-rings

FAQs About: 1/2 CT Fire Opal Flower Engagement Ring with Diamond

What makes fire opal different from other gemstones?
Fire opal is known for its vivid orange to reddish color, which gives it a distinctive and eye-catching appearance. Unlike more traditional gemstones, it offers a bold and warm tone that stands out in jewelry designs.
Is a fire opal ring suitable for engagement use?
Fire opal rings are chosen by those who want a unique and colorful alternative to traditional engagement stones. While suitable for special occasions, they benefit from mindful wear and care.
What does a floral ring design symbolize?
Floral designs in jewelry are often associated with growth, beauty, and natural elegance. They add a soft and decorative element to the ring while enhancing its visual appeal.
What role do the diamond accents play in this ring?
The diamond accents provide brightness and contrast around the fire opal center stone. This helps define the floral shape and adds additional sparkle to the design.
Can this ring be worn daily?
While the ring can be worn regularly, gemstones like fire opal benefit from careful handling. Removing the ring during activities that may cause impact can help maintain its condition.
Who is this ring best suited for?
This ring is ideal for someone who prefers a colorful and expressive engagement style. It appeals to buyers looking for a design that reflects individuality and a more artistic aesthetic.