0.6 Carat London Blue Topaz Floral Engagement Ring with Diamond

Regular price £894.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Allow your affection to flourish with this exquisitely designed Flower Engagement Ring, a captivating piece inspired by the beauty of nature and filled with genuine sparkle. At the heart of the design lies a delicate arrangement of 5 mm round-shaped London Blue Topaz surrounded with round shape Diamonds, set in a floral motif that represents new beginnings and the blossoming of love. Two marquise shape diamonds set on both sides like a petal style, add more charm to the ring. London Blue Topaz stone boasts AAA quality and Diamonds having HI-SI quality, providing a brilliant sparkle that illuminates the entire Floral Ring. Enhancing its allure is the split style band, which adds a hint of modern sophistication and unique texture. This subtle feature imparts a handcrafted essence to the London Blue Topaz Engagement Ring, distinguishing it from conventional designs. The halo style also offers a larger, more striking appearance while ensuring the ring remains lightweight and comfortable for daily wear. Meticulously crafted for those who appreciate beauty and significance, this Blue Topaz Flower Ring is an exquisite option for proposals, anniversaries, or even a meaningful self-love gift. It is available in a variety of metal colors and purity options and is presented in an elegant jewelry box, ready for gifting or personal enjoyment. Romantic, elegant, and refreshingly unique, this Womens Engagement Ring is designed for the individual who believes in love that deepens over time, much like a flourishing garden.

Product Information
SKU SHP-RINGS0821221729
Width 3.8 mm
Height 7 mm
Metal Weight 2.52 gm (Approximate)
Center Stone Weight 0.60 Carat (Approximate)
LONDON BLUE TOPAZ INFORMATION
No.of Stones 1 Pieces
Total Weight 0.60 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Blue
Cut Brilliant
Shape Round
Setting Type Claw-Set
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 16 Pieces
Total Weight 0.32 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-12 Pcs
Marquise-1.50X3.00 mm-4 Pcs
Color HI
Cut Brilliant
Shape Round, Marquise
Setting Type Claw-Set
Quality Grade SI
View More

Product Parent Collection Handle
london-blue-topaz-engagement-rings