1.50 CT Heart Shape Moissanite Crossover Engagement Ring

Regular price £968.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Romantic Form with Modern Expression

This engagement ring is designed for those who prefer symbolism expressed through design. The heart-shaped center introduces an instantly recognizable motif, offering a meaningful interpretation of commitment while maintaining a refined aesthetic.

Its balanced composition allows it to feel expressive without becoming overly ornate.

Crossover Design with Fluid Movement

The crossover structure brings a sense of motion to the ring, creating a gentle flow that wraps around the center stone. This design approach softens the overall look while adding dimension beyond a traditional straight band.

It offers a distinctive alternative for those seeking something different from classic solitaire styles.

Heart Shape as a Focal Point

The heart shape draws attention through its symbolic form and unique outline. It provides a more expressive option compared to conventional cuts, making the ring suitable for those who value individuality in design.

Its placement at the center ensures it remains the defining feature of the piece.

Moissanite as a Contemporary Choice

Moissanite is often selected as an alternative gemstone and is created without traditional mining. Its environmental impact can vary depending on production methods and energy sources.

In this design, it allows the focus to remain on shape and structure rather than additional embellishments.

Designed for Everyday Wearability

The smooth crossover band and considered proportions contribute to a comfortable wearing experience. Its structure avoids unnecessary complexity, allowing the ring to transition easily between daily wear and special occasions.

This versatility supports long-term use while maintaining a refined appearance.

Product Information
SKU SHP-RINGS082211677
Metal Weight 3.80 gm (Approximate)
Center Stone Weight 1.50 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 26 Pieces
Total Weight 1.76 Carat (Approximate)
Dimension(approx) Heart-7X7 mm-1 Pcs
Round-1.10X1.10 mm-25 Pcs
Color White
Cut Brilliant
Shape Heart, Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-rings

Faq About: 1.50 Ct Heart Shape Moissanite Crossover Engagement Ring

Is a heart-shaped ring suitable for an engagement?
A heart-shaped design is often chosen for its symbolic meaning, making it a suitable option for those who prefer a more expressive engagement ring.
What is a crossover band design?
A crossover band features metal that curves and overlaps around the center stone, creating a flowing and dynamic appearance.
Is this ring comfortable for daily wear?
The smooth band structure is designed to provide comfort, making it suitable for regular wear when handled with care.
Can this ring be paired with a wedding band?
It can be paired with a complementary band, though the crossover design may influence how additional rings sit alongside it.
Is moissanite an alternative to traditional gemstones?
Moissanite is often selected as an alternative gemstone and is created without traditional mining, with impact varying based on production methods.
How should I care for this ring?
Regular gentle cleaning and proper storage are recommended to help maintain its appearance over time.