1 Carat Lab Grown Blue Sapphire Engagement Ring with Diamond Crossover Shank

Sale price £930.00 Regular price £1,069.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Designed to celebrate a love that is rare and beautiful, this Lab Grown Blue Sapphire Engagement Ring is a graceful symbol of devotion and timeless romance. At its center shines a brilliant 6 mm Round Shape Lab Created Blue Sapphire set in Prong Setting, glowing with a deep ocean-blue sparkle that captures attention instantly. Below the center stone is a Flower motif that adds a soft, romantic charm, with a hidden surprise Diamond at the center, creating a magical detail that makes the ring even more special. The elegant Crossover Shank flows gently around the finger and is decorated with shimmering Diamond stones, adding layers of brilliance and a modern twist to the design. Every curve of this Solitaire Engagement Ring is thoughtfully crafted to highlight the beauty of the Lab Blue Sapphire while giving the piece a unique and graceful presence. Perfect for a heartfelt proposal or a meaningful gift, this Lab Grown Blue Sapphire Diamond Ring speaks of commitment, admiration and a love that continues to grow with time. This Crossover Ring arrives beautifully placed in a signature jewelry box, making the moment of gifting even more memorable. Available in a range of ring sizes, it allows you to choose the perfect fit for the one who holds your heart forever.

Product Information
SKU SHP-RINGS0821184539
Width 6.5 mm
Height 8.5 mm
Metal Weight 2.70 gm (Approximate)
Center Stone Weight 1.05 Carat (Approximate)
LAB CREATED BLUE SAPPHIRE INFORMATION
No.of Stones 1 Pieces
Total Weight 1.05 Carat (Approximate)
Dimension(approx) Round-6X6 mm-1 Pcs
Color Blue
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAAA
DIAMOND INFORMATION
No.of Stones 58 Pieces
Total Weight 0.40 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-8 Pcs
Round-0.90X0.90 mm-8 Pcs
Round-1X1 mm-40 Pcs
Round-2X2 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
vintage-inspired-engagement-rings