2.2 Carat Freshwater Pearl and Diamond Flower Engagement Ring

Sale price £924.00 Regular price £1,038.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Soft Statement with Floral Elegance

This freshwater pearl and diamond flower ring is designed for those who appreciate refined details over bold statements. The floral composition brings a sense of softness and femininity, making it an ideal choice for occasions where elegance feels more appropriate than excess.

Its presence is noticeable yet composed, offering a design that feels both expressive and wearable.

Floral Form with Balanced Structure

The flower-inspired layout is carefully arranged to maintain visual harmony. Each element works together to create a cohesive silhouette that sits comfortably on the finger without appearing overly intricate.

This thoughtful structure allows the ring to retain its shape and visual clarity from different angles.

Pearl as the Centerpiece

The freshwater pearl introduces a natural softness that contrasts beautifully with the surrounding accents. Its smooth surface adds a gentle glow, giving the ring a distinct character compared to traditional gemstone-centered designs.

This makes it especially appealing for those seeking something less conventional yet still timeless.

Diamond Accents for Subtle Contrast

The diamond details enhance the design by adding controlled brilliance around the central pearl. Rather than dominating the piece, they provide a refined contrast that highlights the overall composition.

The result is a balanced interplay between softness and light.

Designed for Occasional and Thoughtful Wear

This ring is well-suited for special occasions, celebrations, or meaningful gifting moments. Its design leans toward elegance and delicacy, making it a distinctive alternative to more traditional engagement or fashion rings.

It can also be styled as a signature piece when paired with minimal jewelry.

Comfort-Focused Craftsmanship

Despite its detailed appearance, the ring is designed to sit comfortably on the finger. The structure supports ease of wear, allowing it to feel stable without unnecessary bulk.

This ensures it remains enjoyable to wear during extended occasions.

A Distinct Alternative to Classic Designs

By combining a pearl centerpiece with a floral motif, this ring offers a fresh interpretation of fine jewelry. It stands apart from standard solitaire or halo styles, making it suitable for those looking for something more expressive.

The design reflects a balance between traditional inspiration and modern sensibility.

Product Information
SKU SHP-RINGS032210344
Width 7.3 mm
Height 6.5 mm
Weight 3.20 gm (Approximate)
FRESHWATER PEARL INFORMATION
No.of Stones 1 Pieces
Total Weight 2.24 Carat (Approximate)
Dimension(approx) Round-6X6 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Accent
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 2 Pieces
Total Weight 0.10 Carat (Approximate)
Dimension(approx) Round-2X2 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Accent
Quality Grade SI
View More

Product Parent Collection Handle
pearl-rings

Faq About: Freshwater Pearl and Diamond Flower Ring in Gold

Is this ring suitable for everyday wear?
This ring is better suited for occasional or careful wear due to its detailed floral design and pearl centerpiece.
What makes this ring different from traditional diamond rings?
It features a freshwater pearl as the focal point, offering a softer and more distinctive look compared to standard gemstone-centered rings.
Can this ring be used as an engagement ring?
Yes, it can be chosen as a unique engagement ring for those who prefer non-traditional designs.
How should I care for a pearl ring?
Pearls benefit from gentle handling. It is advisable to avoid exposure to harsh chemicals and store the ring separately to maintain its appearance.
Is the ring comfortable to wear for long periods?
The ring is designed to provide a balanced and stable fit, making it comfortable for extended wear during occasions.
Can this ring be paired with other jewelry?
Yes, it pairs well with minimal or classic pieces, allowing the floral design to remain the focal point.