2 Carat Freshwater Pearl and Diamond Flower Engagement Ring

Regular price £1,166.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Bloom with elegance and romance through this Flower Engagement Ring, a design inspired by the most beautiful creations of nature. At its center rests a charming 5 mm Freshwater Pearl, glowing softly as a symbol of purity, love and new beginnings. Surrounding it, a Flower motif with petals makes it look more enchanting. The band, adorned with Diamond stones, adds a graceful shimmer, making every movement catch the light in the most enchanting way. The beauty of a Pearl Flower Ring lies in its meaning, it represents growth, renewal and a love that blossoms. Just like a flower opening to the sun, this Pearl Diamond Engagement Ring symbolizes a relationship that grows stronger, brighter and more meaningful over time. Perfect as an engagement ring, a romantic gesture or a meaningful gift to celebrate a milestone, this Pearl Engagement Ring arrives in a signature jewelry box with multiple ring sizes to suit your choice.

Product Information
SKU SHP-RINGS032210362
Width 8 mm
Height 6.5 mm
Metal Weight 3.60 gm (Approximate)
Center Stone Weight 2.00 Carat (Approximate)
FRESHWATER PEARL INFORMATION
No.of Stones 1 Pieces
Total Weight 2.00 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Bead-Set
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 16 Pieces
Total Weight 0.21 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-16 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Bead-Set
Quality Grade SI
View More

Product Parent Collection Handle
pearl-engagement-rings