2 Carat Lab Grown Diamond Retro Engagement Ring

Regular price £1,304.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Make your special day even more memorable with this stunning Diamond Engagement Ring. This Solitaire Ring showcases an 8 MM round cut synthetic Diamond, beautifully held in double prong setting. The band is embellished with a sequence of round cut diamonds, highlighted by intricate beadwork that gives it a unique step-like design, making the center stone really pop. All the diamonds in this Classic Engagement Ring are lab-grown, and produced in an ethical and eco-friendly way. It's sure to be a beloved addition to her jewelry collection that shell treasure forever.

Product Information
SKU SHP-RINGS052410125
Metal Weight 3.12 gm (Approximate)
Center Stone Weight 2.04 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 25 Pieces
Total Weight 2.23 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-24 Pcs
Round-8X8 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Double-Prong-Setting
Quality Grade EF-VS
View More