2 Carat Lab Grown Diamond Retro Engagement Ring

Sale price £1,146.00 Regular price £1,317.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Make your special day even more memorable with this stunning Lab Created 2 Carat Diamond Engagement Ring. It showcases a 2 Carat round cut synthetic Diamond, beautifully held in double prong setting. The band is embellished with a sequence of round cut diamonds, highlighted by intricate beadwork that gives it a unique step-like design, making the center stone really pop. All the diamonds in this Classic Engagement Ring are lab-grown, and produced in an ethical and eco-friendly way. It is sure to be a beloved addition to her jewelry collection that she will treasure forever. This Round Engagement Ring is designer and beautiful, making it ideal for a woman who wants a classic look with a touch of sparkle. It has a unique charm that combines timeless elegance with a modern vibe, making it a stunning choice that will last forever. It is perfect for brides who dream of a classic, fairytale proposal that feels romantic, adding a subtle yet eye-catching shine that takes the spotlight. The delicate side stones draw your attention to the center, and the round shape in this Retro Style Engagement Ring gives off an elegant feel, adding a trendy twist.

Product Information
SKU SHP-RINGS052410125
Metal Weight 3.90 gm (Approximate)
Center Stone Weight 2.04 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 25 Pieces
Total Weight 2.23 Carat (Approximate)
Dimension(approx) Round-8X8 mm-1 Pcs
Round-1.20X1.20 mm-24 Pcs
Color E-F
Cut Brilliant
Shape Round
Setting Type Double-Prong-Setting
Quality Grade VS
View More