2 Carat Round Solitaire Lab Grown Diamond Teardrop Necklace

Sale price £1,129.00 Regular price £1,298.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Elevate your style with the enchanting Lab Grown Diamond Pendant featuring a Star Motif, an ideal accessory for any occasion, day or night. This Teardrop Pendant Necklace highlights a 2 Carat round-shaped Synthetic Diamond of EF-VS quality securely set in prong setting, radiating brilliance. The charming Star Motif, adorned with a dainty round diamond, brings a hint of the celestial to this exquisite piece. This Diamond Solitaire Pendant complements any outfit, whether you are dressing up or keeping it casual. The stunning piece shines brightly and offers a continuous sparkle, blending timeless elegance with modern style. Hanging from a chain, this Diamond Drop Necklace is made with great attention to detail and delicate touches. Its refined elegance and modern design make it a perfect statement piece for todays woman, catching eyes and providing an endless display of sparkle. The EF Color VS Clarity Lab Grown Diamond showcases a bold expression of luxury and shine, made for occasions that require a stunning display of brilliance. Glamorous and eye-catching, this 2 Carat Diamond Necklace has a natural grace and classic beauty that will be a treasured addition to any outfit. It can be worn by itself or layered with other pendants to add a hint of modern luxury.

Product Information
SKU SHP-PENDANT082310791
Metal Weight 4.10 gm (Approximate)
Total Stone Weight 2.08 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 2 Pieces
Total Weight 2.08 Carat (Approximate)
Dimension(approx) Round-8X8 mm-1 Pcs
Round-2.10X2.10 mm-1 Pcs
Color E-F
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade VS
View More