4.3 Carat Certified Lab Created Emerald Floral Stud Earrings

Sale price £540.00 Regular price £620.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Elevate your style with our Emerald Stud Earrings that infuse a delightful hue into your life. The 8 MM Round Cut Lab-Created Emerald is designed to capture the attention. The elegant floral motif at the back sparkles with the unmatchable brilliance of Moissanite stones, resulting in the captivating and sophisticated appearance of these Lab Grown Emerald Earrings. Exquisitely secured with Screw-Back closure to keep them intact in the earlobe and provide a comfortable fit. Embrace your favorite outfit when you wear these emerald studs, a burst of sparkle on your ears. This pair of Flower Stud Earrings comes with a certificate of authenticity, ensuring that you receive certified and top-notch stones. The Emerald and Moissanite Earrings are elegantly presented in a beautiful jewelry box, making them a perfect gift for birthdays, anniversaries, or any special event. They also serve as a wonderful indulgence for yourself if you love classic and stylish jewelry.

Product Information
SKU SHP-EARRINGS112114651
Length 8.8 mm
Width 8.8 mm
Height 6 mm
Metal Weight 1.90 gm (Approximate)
Total Stone Weight 4.82 Carat (Approximate)
LAB CREATED EMERALD INFORMATION
No.of Stones 2 Pieces
Total Weight 4.36 Carat (Approximate)
Dimension(approx) Round-8X8 mm-2 Pcs
Color Green
Cut Brilliant
Shape Round
Setting Type Flower / Floral
Quality Grade AAAA
MOISSANITE INFORMATION
No.of Stones 96 Pieces
Total Weight 0.46 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-64 Pcs
Round-1.10X1.10 mm-32 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Flower / Floral
Quality Grade D-VS1
View More

Product Parent Collection Handle
stud-earrings