6 Carat Lab Grown Orange Sapphire Oval Engagement Ring with Diamond Butterfly

Sale price £1,096.00 Regular price £1,260.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Bold Centerpiece with Distinctive Color

The 6 Carat Lab Grown Orange Sapphire Oval Engagement Ring with Diamond Butterfly is crafted for those who appreciate vibrant color and expressive design. The substantial oval center stone creates strong visual impact, making this ring ideal for individuals who want their engagement piece to stand apart from traditional styles.

Its warm orange hue brings energy and individuality to a meaningful symbol of commitment.

Oval Silhouette with Butterfly Detail

The oval cut enhances the presence of the center stone while maintaining elegant proportions on the hand. The diamond butterfly accent introduces a refined decorative element, adding character without overwhelming the design.

This combination of bold center stone and delicate motif offers balance between statement and structure, making the ring visually engaging from multiple angles.

Lab Grown Orange Sapphire with Diamond Accents

Lab grown sapphires are created without traditional mining, offering an alternative to naturally sourced stones. Their impact varies by production and energy source. The vivid orange tone delivers strong color saturation, while diamond accents provide contrast and additional brilliance.

For exact specifications including carat weight, dimensions, and metal options, please refer to the product detail tables below.

High-Level Features

  • 6 carat oval lab grown orange sapphire center stone.
  • Diamond butterfly accent for added visual interest.
  • Statement engagement design with strong color presence.
  • Complete technical details available in the product tables.
Product Information
SKU SHP-RINGS062310094
Weight 4.60 gm (Approximate)
Center Stone Weight 6.00 Carat (Approximate)
LAB CREATED ORANGE SAPPHIRE INFORMATION
No.of Stones 1 Pieces
Total Weight 6.00 Carat (Approximate)
Dimension(approx) Oval-10X14 mm-1 Pcs
Color Orange
Cut Brilliant
Shape Oval
Setting Type Prong-Setting
Quality Grade AAAA
DIAMOND INFORMATION
No.of Stones 16 Pieces
Total Weight 0.23 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-4 Pcs
Round-1.10X1.10 mm-4 Pcs
Round-1.40X1.40 mm-4 Pcs
Round-1.70X1.70 mm-4 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
lab-created-orange-sapphire-rings

FAQs about: 6 Carat Lab Grown Orange Sapphire Oval Engagement Ring with Diamond Butterfly