8 Carat Black Pearl and Diamond Bridal Pendant Necklace

Regular price £1,178.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Make space in your jewelry collection for a piece that naturally draws attention. This Black Pearl Pendant is designed to stand out with its rich color and graceful detailing. Curated with a stunning 10 MM round Tahitian pearl, secured in a classic bead setting, keeping it safely in place while allowing its natural beauty to shine. Flanking the pearl is a delicate leaf motif, beautifully decorated with tiny round diamond stones. The nature-inspired leaf design brings an elegant and artistic touch, making the Leaf Pendant Necklace feel both timeless and unique. Adding to its charm, the bail features tiny beaded detailing that enhances the overall look. This small yet thoughtful detail gives the pendant extra character and a refined finish. Every element works together to create a balanced design that feels luxurious. The Pearl and Diamond Necklace hangs from a cable chain, which is available as an optional add-on. You can choose to purchase it with the chain for a ready-to-wear piece or without it if you prefer to pair the pendant with your own favorite chain. Perfect for special occasions or everyday elegance, this Tahitian Pearl Pendant brings sophistication, shine, and a touch of nature-inspired beauty to any outfit.

Product Information
SKU SHP-PENDANT122036260
Metal Weight 4.20 gm (Approximate)
Total Stone Weight 8.16 Carat (Approximate)
TAHITIAN PEARL INFORMATION
No.of Stones 1 Pieces
Total Weight 8.00 Carat (Approximate)
Dimension(approx) Round-10X10 mm-1 Pcs
Color Black
Cut Brilliant
Shape Round
Setting Type Bead-Set
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 26 Pieces
Total Weight 0.16 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-2 Pcs
Round-0.90X0.90 mm-8 Pcs
Round-1.10X1.10 mm-3 Pcs
Round-1.20X1.20 mm-2 Pcs
Round-1X1 mm-11 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Bead-Set
Quality Grade SI
View More

Product Parent Collection Handle
tahitian-pearl-necklaces