Baguette Cut Lab Grown Orange Sapphire and Diamond Eternity Ring

Sale price £670.00 Regular price £770.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

A circle of fire and brilliance, this Orange Sapphire Eternity Ring is where vibrant passion meets timeless sophistication. The band is adorned with a stunning sequence of baguette cut lab created orange sapphires and brilliant round lab grown diamonds, creating a breathtaking contrast of vivid color and sparkling light. Each gemstone is thoughtfully placed in a perfectly balanced arrangement, giving the Sapphire and Diamond Wedding Band a luxurious and eye-catching appeal that effortlessly stands out. Together, the combination of AAAA quality lab orange sapphires and luminous EF-VS quality lab made diamonds creates a harmonious display of glamour and grace. Crafted as a full eternity band, every stone is meticulously set with precision around the entire ring, symbolizing endless love, unity, and commitment. Perfect as a wedding band, anniversary ring, statement piece, or meaningful gift, this Orange Sapphire Wedding Band captures the essence of romance and individuality. Whether worn alone for a bold and elegant look or stacked with other rings for added sophistication, it offers versatility and timeless charm.

Product Information
SKU SHP-RINGS032219811
Metal Weight 2.16 gm (Approximate)
Total Stone Weight 1.85 Carat (Approximate)
LAB CREATED ORANGE SAPPHIRE INFORMATION
No.of Stones 6 Pieces
Total Weight 1.19 Carat (Approximate)
Dimension(approx) Baguette-2X4 mm-6 Pcs
Color Orange
Cut Brilliant
Shape Baguette
Setting Type Prong-Setting
Quality Grade AAAA
LAB GROWN DIAMOND INFORMATION
No.of Stones 6 Pieces
Total Weight 0.66 Carat (Approximate)
Dimension(approx) Round-3X3 mm-6 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More

Product Parent Collection Handle
lab-created-orange-sapphire-rings