Black Onyx Double Heart Promise Ring with Diamond Accents

Sale price £594.00 Regular price £667.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Celebrate a promise shared between two people with this black onyx double heart promise ring with diamond accents. Two heart-shaped black onyx gemstones face one another in an open cuff design, creating a visual connection between two distinct forms. Three round diamonds add small flashes of brightness against the deep black stones, making the ring a meaningful choice for a relationship promise, anniversary, romantic gift, or personal milestone.

0.58 Carat Black Onyx Double Heart Promise Ring with Diamond

The design carries approximately 0.58 carat of total gemstone weight. Two AAA-quality heart-shaped black onyx stones contribute approximately 0.50 carat and measure about 4 x 4 mm each. Brilliant-cut faceting and claw settings keep their distinctive heart outlines prominent. Three round brilliant diamonds totaling approximately 0.08 carat are positioned along the ring, bringing a refined contrast of light against the black onyx.

Double Heart Black Onyx Ring Details

  • Two heart-shaped black onyx gemstones
  • Approximately 0.50 carat total black onyx weight
  • Approximately 4 x 4 mm heart-shaped stones
  • AAA-quality black onyx with brilliant-cut faceting
  • Claw-set onyx gemstones
  • Three round brilliant diamond accents totaling approximately 0.08 carat
  • HI color and SI quality diamond accents
  • Approximately 1.50 x 1.50 mm round diamonds
  • Open cuff and double heart design
  • Approximately 0.58 carat total stone weight
  • Approximately 3.5 mm width and 7 mm height
  • Approximate metal weight of 2.00 grams

The open arrangement gives each heart room to stand out while the diamond accents introduce brightness between the darker gemstones. This balance of bold black color, romantic symbolism, and an airy silhouette sets the design apart from a conventional closed-band promise ring.

Meaning Behind the Black Onyx Double Heart Promise Ring

The facing heart motif naturally represents two people connected while retaining their individuality, making the design especially relevant to commitment and promise gifting. Black onyx gives the hearts a bold, expressive character, while the open cuff creates a sense of two forms moving toward one another. Small diamond accents bring contrast and light to the composition, reinforcing the emotional balance between strength, affection, and shared connection.

Black Onyx and Diamond Craftsmanship & Authenticity

Rosec Jewels crafts the ring with attention to the alignment of the two heart-shaped stones, claw-setting security, diamond placement, and refined finishing. Each piece goes through stone inspection, setting security review, and finishing inspection before dispatch. Rosec Jewels also offers a Certificate of Authenticity with its jewelry, adding confidence to the purchase experience. For ongoing care, gentle cleaning, separate storage, and protection from harsh chemicals and impact can help maintain the black onyx, diamond settings, and sterling silver finish.

Styling and Wearing a Double Heart Promise Ring

From above, the two black onyx hearts create an immediate focal point, while the open wrap profile gives the ring a less conventional, more expressive appearance. Its black-and-white gemstone contrast works naturally with both minimal and statement jewelry, while the sterling silver setting keeps the overall palette cool-toned. Wear it as a romantic promise ring, meaningful anniversary gift, two-stone symbolic ring, or personal reminder of an important bond. For regular wear, remove it during heavy work or activities that could expose the claw-set stones to strong impact.

Product Information
SKU SHP-RINGS0821218229
Width 3.5 mm
Height 7 mm
Metal Weight 2.00 gm (Approximate)
Total Stone Weight 0.58 Carat (Approximate)
BLACK ONYX INFORMATION
No.of Stones 2 Pieces
Total Weight 0.50 Carat (Approximate)
Dimension(approx) Heart-4X4 mm-2 Pcs
Color Black
Cut Brilliant
Shape Heart
Setting Type Claw-Set
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 3 Pieces
Total Weight 0.08 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-3 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Claw-Set
Quality Grade SI
View More

Product Parent Collection Handle
black-onyx-rings

FAQs About: Genuine Black Onyx Double Heart Promise Ring with Diamond

How many black onyx stones are in this double heart promise ring?

The ring features two heart-shaped black onyx gemstones with a combined approximate weight of 0.50 carat. Each stone measures about 4 x 4 mm and is graded AAA quality.

What cut and setting are used for the black onyx hearts?

The black onyx gemstones are heart-shaped with brilliant-cut faceting and are secured in claw settings. The two stones face one another as part of the open cuff design.

Does this black onyx promise ring include real diamond accents?

The design includes three round brilliant diamonds totaling approximately 0.08 carat. Each measures about 1.50 x 1.50 mm, with HI color and SI quality grading, and the diamonds are secured in claw settings.

What does the double heart promise ring design symbolize?

The two facing hearts can represent two people coming together while remaining distinct individuals. This gives the double heart design natural meaning for promises, romantic commitments, anniversaries, and other relationship milestones.

What metal is used for this black onyx and diamond ring?

The ring is crafted in 92.5 sterling silver. It measures approximately 3.5 mm in width and 7 mm in height, with an approximate metal weight of 2.00 grams.

Does this black onyx double heart ring come with a Certificate of Authenticity?

Rosec Jewels offers a Certificate of Authenticity with its jewelry as part of its product assurance and quality-focused purchase experience.

How should I care for a black onyx and diamond promise ring?

Store the ring separately to reduce scratches, keep it away from harsh chemicals and strong impact, and clean it gently with a soft cloth. Removing it during heavy work, swimming, or cleaning can also help protect the claw settings and sterling silver finish.