Brilliant Cut Diamond Wing Helix Drop Earring with Flat Back

Sale price £387.00 Regular price £444.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Sculpted Accent for the Helix

This brilliant cut diamond wing helix drop earring is designed for those who appreciate refined cartilage jewelry with a distinctive silhouette. The wing-inspired form follows the natural curve of the ear, creating a subtle yet expressive statement.

Its drop detail adds movement while maintaining a balanced, lightweight appearance suited to curated ear styling.

Wing Motif with Brilliant Cut Sparkle

The wing design is enhanced by brilliant cut diamonds that reflect light with crisp clarity. The arrangement creates a defined outline while allowing each stone to contribute to an overall shimmering effect.

The structured setting supports the stones securely, preserving both form and brilliance in a compact cartilage-friendly design.

Flat Back for Secure, Low-Profile Wear

The flat back construction is intended for comfort in helix and cartilage piercings. Its smooth, low-profile base sits close to the ear, helping reduce pressure during extended wear.

This thoughtful detail makes the piece suitable for those seeking a secure and practical alternative to traditional butterfly backs.

Designed for Modern Ear Styling

Whether worn as a standalone highlight or paired within a curated ear stack, this diamond helix drop earring offers a contemporary balance of structure and fluidity. Its wing-inspired silhouette adds character without overwhelming the overall look.

Product Information
SKU SHP-BODYJ052310081
Metal Weight 0.90 gm (Approximate)
Total Stone Weight 0.45 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 10 Pieces
Total Weight 0.45 Carat (Approximate)
Dimension(approx) Round-2X2 mm-1 Pcs
Marquise-2X4 mm-1 Pcs
Round-1.50X1.50 mm-4 Pcs
Marquise-1.50X3.00 mm-4 Pcs
Color HI
Cut Brilliant
Shape Round, Marquise
Setting Type Prong-Setting
Quality Grade SI
View More

FAQs About: Diamond Wing Helix Drop Earring

Is this earring suitable for helix piercings?
Yes, it is specifically designed for helix and cartilage placements, offering a shape that follows the ear’s natural contour.
What is the benefit of a flat back design?
A flat back provides a smooth surface against the ear, helping improve comfort and reduce irritation compared to traditional post backs.
Are the diamonds securely set for daily wear?
The diamonds are set within a structured design to help maintain stability and brilliance when worn with proper care.
Is this sold as a single earring or a pair?
Please refer to the product details table on this page for confirmation of whether the item is offered as a single piece or a pair.
Can this earring be styled with other cartilage jewelry?
Yes, its sculpted wing silhouette and compact size make it suitable for pairing with studs or small hoops in a curated ear arrangement.