Brilliant Cut Moissanite Infinity Promise Ring for Her

Sale price £559.00 Regular price £642.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

This Infinity Promise Ring is a sweet and meaningful piece, designed to symbolize a love that lasts forever. At the center of this delicate design are two stunning pear cut moissanite stones set in prong setting with a curved row of round cut stones creating an infinity motif. Together, they beautifully represent the idea of two souls coming together as one, making this Moissanite Promise Ring for Her a heartfelt gift for someone special or even a meaningful self-love token. The infinity design flows smoothly across the finger, giving the Minimalist Ring a graceful and modern look. Whether you see it as a promise ring, a two stone ring, or simply a symbol of connection and commitment, it is a piece that tells a quiet, powerful story. It is light, elegant, and incredibly wearable, perfect for everyday moments or special occasions alike. The blend of pear and round cuts brings balance and harmony to the design, and the thoughtful placement of every stone creates a soft shimmer from every angle. If you are looking for something that blends emotion, meaning, and beauty in a graceful way, this Moissanite Infinity Ring is a lovely choice that feels just as personal as the bond it represents.

Product Information
SKU SHP-RINGS032221894
Metal Weight 2.20 gm (Approximate)
Total Stone Weight 0.56 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 11 Pieces
Total Weight 0.56 Carat (Approximate)
Dimension(approx) Pear-3X5 mm-2 Pcs
Round-1.40X1.40 mm-4 Pcs
Round-1.50X1.50 mm-3 Pcs
Round-1X1 mm-2 Pcs
Color White
Cut Brilliant
Shape Pear, Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
mothers-day-gifts