Certified 0.9 Carat Round Diamond Promise Engagement Ring For Her

Regular price £682.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Celebrate love with timeless elegance and a touch of artistic charm in this Promise Engagement Ring. Embellished with a 6 MM Round Shape Lab Grown Diamond set in Double Prong Setting as a centerpiece, known for its exceptional clarity, brilliance, and ethical sparkle. What makes this Lab Grown Diamond Ring truly special is the unique trio of horizontally placed Marquise Shape Lab Diamond stones on each side of the center stone, forming a delicate leaf like motif that adds a romantic twist. Designed to symbolize eternal love and growth, this 1 Ct Lab Grown Diamond Ring beautifully blends tradition with modern creativity. Perfect for proposals or heartfelt promises, this Round Diamond Engagement Ring (Lab Created) is a meaningful reminder of the moments that matter most. Handcrafted with perfection and attention to detail, this Man Made Diamond Engagement Ring is ideal for daily wear and forever memories. Whether you are planning a surprise or picking it together, this Ethical Engagement Ring captures the essence of your story. Let your forever begin with a sparkle that feels just right.

Product Information
SKU SHP-RINGS062510205
Width 6 mm
Height 3.8 mm
Metal Weight 1.80 gm (Approximate)
Center Stone Weight 0.99 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 7 Pieces
Total Weight 1.16 Carat (Approximate)
Dimension(approx) Marquise-1.50X3.00 mm-6 Pcs
Round-6X6 mm-1 Pcs
Color White
Cut Brilliant
Shape Marquise, Round
Setting Type Double-Prong-Setting
Quality Grade EF-VS
View More