Certified 2 Carat Ethiopian Opal Heart Engagement Ring with Celtic Knot

Regular price £891.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Heart Shaped Ethiopian Opal Engagement Ring

This engagement ring features an Ethiopian opal center stone cut in a heart shape, creating a design that emphasizes both symbolism and distinctive gemstone character. The opal’s shifting play of color makes it a visually dynamic centerpiece while the heart shape adds a romantic element to the overall design.

Celtic Knot Band Design

The band incorporates Celtic knot detailing, a design style recognized for its continuous interwoven pattern. This motif is often associated with ideas of eternity and interconnectedness, making it a meaningful design element within engagement jewelry.

Ethiopian Opal Center Stone

Ethiopian opal is known for its vibrant play-of-color effect, where flashes of multiple colors appear as light interacts with the gemstone. This natural optical phenomenon gives the stone a distinctive and constantly changing appearance.

Heart Cut Symbolism

The heart cut is traditionally associated with expressions of love and affection. When paired with the vivid character of opal, the shape creates a design that balances visual interest with romantic symbolism.

Distinctive Engagement Ring Style

The combination of a heart-shaped opal and a Celtic knot band results in a ring that blends gemstone individuality with symbolic design elements. This style appeals to those who appreciate engagement jewelry with both visual uniqueness and meaningful detailing.

Product Information
SKU SHP-RINGS0821133062
Width 5 mm
Height 9.2 mm
Weight 3.22 gm (Approximate)
Center Stone Weight 2.00 Carat (Approximate)
ETHIOPIAN OPAL INFORMATION
No.of Stones 1 Pieces
Total Weight 2.00 Carat (Approximate)
Dimension(approx) Heart-8X8 mm-1 Pcs
Color Rainbow
Cut Brilliant
Shape Heart
Setting Type Prong-Setting
Quality Grade AAA
View More

Product Parent Collection Handle
opal-rings

FAQs About: Certified Ethiopian Opal Heart Engagement Ring with Celtic Knot

What is Ethiopian opal known for?
Ethiopian opal is known for its play-of-color effect, where flashes of different colors appear as light moves across the gemstone. This optical characteristic makes each opal visually unique.
What does a Celtic knot ring symbolize?
Celtic knot designs feature continuous looping patterns that have no beginning or end. These motifs are often associated with ideas of eternity, unity, and interconnectedness.
Why choose a heart-shaped gemstone for an engagement ring?
Heart-shaped gemstones are commonly associated with love and romance. The shape is often selected for engagement rings to emphasize emotional symbolism alongside visual design.
Is opal suitable for engagement rings?
Opal can be used in engagement rings, though it benefits from careful handling due to its delicate nature. Proper care helps preserve the stone’s appearance over time.
How should an opal ring be cleaned?
Clean an opal ring using a soft damp cloth and mild soap if needed. Avoid harsh chemicals and ultrasonic cleaners to protect the gemstone’s structure and surface.