Certified Black Onyx Flower Clusters Engagement Ring

Sale price £733.00 Regular price £823.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Choose a floral engagement ring with a striking monochrome look in this Certified Black Onyx Flower Engagement Ring. Three flower clusters stretch across the front of the band, each formed from round black onyx stones for a bold botanical composition. The deep black gemstones and sculpted floral arrangement make this ring a distinctive choice for proposals, anniversaries, commitment milestones, or someone who prefers unconventional gemstone jewelry.

1.83 Carat Black Onyx Flower Engagement Ring

The design features 23 round black onyx stones with an approximate combined weight of 1.83 carats. Three larger stones measure about 3 x 3 mm, while 20 smaller stones measure approximately 2 x 2 mm, creating the layered flower-cluster arrangement. Each black onyx has brilliant-cut faceting, AAA quality, and a prong setting. The ring is crafted in 92.5 sterling silver with an approximate metal weight of 2.49 grams and measures about 7 mm wide and 4 mm high.

What Makes This Black Onyx Flower Ring Special

  • Twenty-three round black onyx stones totaling approximately 1.83 carats.
  • Three floral clusters arranged across the front of the ring.
  • Three larger 3 x 3 mm stones form prominent floral centers.
  • Twenty 2 x 2 mm black onyx stones complete the clustered design.
  • AAA quality gemstones with brilliant-cut faceting.
  • Prong settings define the individual stones within each flower.
  • Approximately 7 mm width creates noticeable floral coverage across the finger.
  • Crafted in 92.5 sterling silver and selected yellow or white gold options in 10K, 14K, and 18K with an approximate metal weight of 2.49 grams.

Meaning Behind the Black Onyx Flower Engagement Ring

The three-flower arrangement gives this engagement ring a nature-inspired identity associated with growth and new beginnings, making the motif especially fitting for a new chapter together. Rather than relying on one dominant center stone, the clustered black onyx design creates interest across the band. Its deep monochrome color also offers a more individual alternative to conventional clear-stone engagement styles.

Certified Black Onyx Ring Authenticity & Craftsmanship

Rosec Jewels crafts its gemstone jewelry with attention to stone placement, secure prong settings, and refined finishing. Rosec Jewels offers a Certificate of Authenticity with its jewelry for added purchase confidence. Each piece also goes through stone inspection, setting security review, and finishing inspection before dispatch, with care guidance provided to support responsible long-term wear.

Styling a Black Onyx Floral Engagement Ring

The 7 mm floral profile gives the black onyx clusters a noticeable presence from above while the smooth band keeps the composition focused across the front of the finger. Sterling silver creates a crisp contrast around the dark gemstones and pairs naturally with other silver-toned jewelry. Wear it as an alternative engagement ring, anniversary piece, statement ring, or meaningful gift for someone drawn to floral and black gemstone designs.

Product Information
SKU SHP-RINGS0821188836
Width 7 mm
Height 4 mm
Metal Weight 2.49 gm (Approximate)
Total Stone Weight 1.83 Carat (Approximate)
BLACK ONYX INFORMATION
No.of Stones 23 Pieces
Total Weight 1.83 Carat (Approximate)
Dimension(approx) Round-2X2 mm-20 Pcs
Round-3X3 mm-3 Pcs
Color Black
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
View More

Product Parent Collection Handle
black-onyx-rings

FAQs About: Certified Black Onyx Flower Engagement Ring

How many black onyx stones are in this flower engagement ring?

The ring contains 23 round black onyx stones with an approximate combined weight of 1.83 carats. They are arranged into three floral clusters across the front of the band.

What sizes and quality are the black onyx stones?

The design uses three round black onyx stones measuring approximately 3 x 3 mm and 20 stones measuring about 2 x 2 mm. All are brilliant cut and graded AAA quality.

What setting is used for the black onyx flower clusters?

The round black onyx stones are secured in prong settings. This allows the individual gemstones to remain clearly defined while forming the three clustered flower motifs.

What does the flower design symbolize in this engagement ring?

The floral motif is associated with growth and new beginnings, giving the design meaningful relevance for engagements and other relationship milestones. Its three flower clusters also create a distinctive nature-inspired alternative to a traditional solitaire ring.

What metal is used for this black onyx engagement ring?

The confirmed design is crafted in 92.5 sterling silver and selected yellow or white gold options in 10K, 14K, and 18K with an approximate metal weight of 2.49 grams. The ring measures about 7 mm in width and 4 mm in height.

Does this black onyx flower ring come with a Certificate of Authenticity?

Rosec Jewels offers a Certificate of Authenticity with its jewelry for added purchase confidence. Pieces also go through stone inspection, setting security review, and finishing inspection before dispatch.

How should I care for a black onyx flower engagement ring?

Clean the ring gently with mild soap, lukewarm water, and a soft cloth, then dry it carefully. Avoid harsh chemicals, abrasive surfaces, and strong impacts, store the ring separately when not worn, and periodically check the prong settings to help keep the onyx stones secure.