Certified Diamond Butterfly Cartilage Earring

Regular price £412.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Delicate Accent for Cartilage Piercing

The certified diamond butterfly cartilage earring is designed for those who prefer refined detail in a smaller, curated ear look. The butterfly motif introduces a soft, expressive element while maintaining proportions suited for cartilage placement.

Its compact scale makes it appropriate for helix and upper ear piercings, offering subtle brilliance without overwhelming the ear.

Butterfly Motif with Secure Setting

The butterfly silhouette is structured for symmetry and balance. Each diamond is set to enhance the outline of the design while preserving a smooth finish suitable for close-to-ear wear.

The setting is crafted to sit securely in cartilage piercings, supporting stability and comfort throughout the day when worn as intended.

Certified Diamond Detail

The diamonds featured in this earring are certified, providing documented grading information for added transparency. Diamonds are durable and generally suitable for everyday wear when handled with appropriate care.

As a single cartilage earring, it is designed to complement other studs or minimalist pieces in a curated ear arrangement.

High-Level Features

  • Certified diamond accents
  • Butterfly-inspired silhouette
  • Designed for cartilage piercings
  • Suitable for curated ear styling
Product Information
SKU SHP-BODYJ052310084
Metal Weight 0.80 gm (Approximate)
Total Stone Weight 0.14 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 34 Pieces
Total Weight 0.14 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-6 Pcs
Round-0.80X0.80 mm-28 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade SI
View More
Is this sold as a single cartilage earring?
This product is offered as a single cartilage earring. Please review the product detail tables for confirmation of what is included.
What does certified diamond mean for this earring?
A certified diamond includes grading documentation outlining key characteristics such as cut, clarity, color, and carat weight, depending on the certification provided.
Is it suitable for everyday wear?
Diamonds are durable and suitable for regular wear when handled with care. Removing the earring during strenuous activity is recommended.
Can it be worn in other ear piercings?
While designed for cartilage placement, suitability for other piercings depends on individual piercing size and specifications listed in the product detail tables.
Where can I find full specifications and metal options?
Complete specifications, dimensions, and available metal options are provided in the product detail tables on this page.