Certified Diamond Cat Stud Earrings

Sale price £492.00 Regular price £566.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Created for cat lovers who want jewelry with sentiment, these certified diamond cat stud earrings carry a sweet story in a sparkling silhouette. The design brings together a mommy cat and kitten motif, expressing companionship, affection, protection, and the warm bond shared with a beloved pet. Round diamonds add a soft shimmer across the cat-inspired form, making the pair a heartfelt gift for a daughter, teen, animal lover, or anyone who keeps feline joy close to the heart.

Cat Stud Earrings with Round Brilliant Prong Set of Diamonds

These diamond cat stud earrings are crafted with 36 round diamonds in a prong setting, creating an approximate total stone weight of 0.14 carat. The diamonds are brilliant cut, HI in color, and SI in quality grade, adding refined sparkle to the playful mother-and-kitten design. Available in sterling silver and multiple gold options, the pair blends whimsy, emotional meaning, and polished everyday wear.

What Makes This Special

The stud earrings feature 36 round diamonds with an approximate total weight of 0.14 carat. Each diamond measures approximately 0.90 x 0.90 mm, creating delicate sparkle across the cat-inspired stud design.

The diamonds are round in shape, brilliant cut, HI color, SI quality grade, and secured in prong settings. The design centers on a mommy cat and kitten motif, giving the earrings a warm and affectionate identity while keeping the overall look wearable and charming.

The pair has an approximate metal weight of 2.10 gm. Gemstone quality options include lab diamond EF-VS and natural diamond HI-SI, while metal options include 92.5 sterling silver, 10K yellow gold, 10K white gold, 14K yellow gold, 14K white gold, 18K yellow gold, and 18K white gold.

Why Choose This Design

Cat-themed jewelry feels personal because it connects directly to companionship, comfort, and personality. These studs turn that affection into a refined accessory, using round diamonds to add light without overpowering the sweet motif.

The prong setting helps define the diamond accents while keeping the stones visually open. The stud style makes the earrings easy to wear with casual outfits, work looks, or playful weekend styling, offering a meaningful alternative to plain diamond studs.

Design Meaning

The cat motif represents grace, curiosity, independence, protection, and companionship. With the mommy cat and kitten design, the earrings also carry a tender message of care, closeness, and the biological bond between mother and child. For pet lovers, the design can feel like a tribute to the joy cats bring into daily life; for gifting, it becomes a small reminder of affection, comfort, and connection.

Authenticity & Craftsmanship

Each pair is carefully crafted with attention to diamond placement, prong setting security, cat motif detail, and refined finishing. Rosec Jewels offers a Certificate of Authenticity with the product, adding confidence to the purchase experience. Before dispatch, every piece goes through stone inspection, setting security review, and finishing inspection to help ensure it is ready to wear or gift. For lasting care, store the earrings separately, avoid harsh chemicals, and clean gently with a soft cloth after wear.

Style and Wearability

These diamond earrings bring a playful sparkle to the ear while staying polished enough for everyday styling. They pair naturally with simple diamond necklaces, delicate bracelets, animal-inspired jewelry, or plain gold pieces. Their expressive motif makes them especially thoughtful for birthdays, pet memorial gifts, friendship gifts, mother-daughter moments, or a personal jewelry piece that quietly celebrates feline love.

Product Information
SKU SHP-EARRINGS012148856
Metal Weight 2.10 gm (Approximate)
Total Stone Weight 0.14 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 36 Pieces
Total Weight 0.14 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-36 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
moissanite-earrings

FAQs About: Certified Diamond Cat Stud Earrings

What makes these diamond cat stud earrings a meaningful gift?

The mommy cat and kitten motif represents affection, protection, companionship, and the bond between mother and child. This makes the earrings a thoughtful gift for cat lovers, daughters, teens, pet parents, or anyone who appreciates meaningful animal-inspired jewelry.

How many diamonds are used in these cat earrings?

The earrings include 36 round diamonds with an approximate total weight of 0.14 carat. Each diamond measures approximately 0.90 x 0.90 mm.

What cut, color, and quality are listed for the diamonds?

The diamonds are round in shape with brilliant cut faceting. They are listed as HI color and SI quality grade, with gemstone quality options available in lab diamond EF-VS and natural diamond HI-SI.

What setting style is used for these earrings?

The diamonds are secured in prong settings. This setting style helps define the sparkle across the cat-inspired design while keeping the small round diamonds visible.

What does the cat design symbolize?

The cat motif is connected with grace, curiosity, independence, and protection. The mommy cat and kitten theme adds a deeper message of care, companionship, and the close bond shared with someone loved.

What metal options are available for these diamond cat studs?

This design is available in 92.5 sterling silver, 10K yellow gold, 10K white gold, 14K yellow gold, 14K white gold, 18K yellow gold, and 18K white gold, giving buyers several choices in metal tone and purity.

How should I care for these diamond cat stud earrings?

Store the earrings separately to help prevent scratches, avoid harsh chemicals, and wipe them gently with a soft cloth after wear. For deeper cleaning, use mild soap, lukewarm water, and a soft brush, then dry them carefully before storing.