Certified Diamond Drop Bow Necklace

Regular price £1,227.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Feminine Design with Subtle Movement

This diamond drop bow necklace is designed for those who appreciate soft detailing with a refined structure. The bow motif introduces a graceful shape, while the drop element adds a sense of movement without overwhelming the design.

Its composition makes it suitable for both everyday wear and special occasions.

Bow Motif with Structured Drop Setting

The bow design is crafted to create a balanced and symmetrical appearance, while the drop element enhances the vertical flow of the necklace. This combination adds visual interest while maintaining a controlled and elegant silhouette.

The setting ensures that each element remains secure while preserving the fluid look of the design.

Diamonds with Refined Brilliance

Diamonds are used to provide subtle brightness, enhancing the contours of the bow and drop design. Their placement supports a balanced level of brilliance that complements the overall structure rather than dominating it.

This approach results in a necklace that feels polished and wearable across different settings.

Designed for Versatile Styling

This necklace is suitable for daily wear while also adapting easily to more formal occasions. Its lightweight design allows for comfortable use throughout the day.

It can be worn alone for a clean look or layered with other pieces for added depth.

Product Information
SKU SHP-PENDANT062210081
Weight 2.72 gm (Approximate)
DIAMOND INFORMATION
No.of Stones 28 Pieces
Total Weight 0.29 Carat (Approximate)
Dimension(approx) Pear-3X5 mm-1 Pcs
Round-0.90X0.90 mm-27 Pcs
Color HI
Cut Brilliant
Shape Pear, Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
diamond-necklaces

FAQs About: Certified Diamond Drop Bow Necklace

Is this necklace suitable for daily wear?
Yes, its balanced and lightweight design makes it suitable for everyday wear with proper care.
What does the bow design represent?
The bow motif is often associated with elegance, femininity, and graceful styling.
Does the drop design affect how the necklace sits?
The drop element adds vertical movement while maintaining a balanced and comfortable fit on the neckline.
Can this necklace be layered with others?
Yes, it can be layered with other necklaces for a more personalized styling approach.
Does this necklace include a chain?
Please refer to the product details table to confirm whether a chain is included with the necklace.
How should this necklace be cared for?
Clean gently with a soft cloth, avoid harsh chemicals, and store separately to maintain its finish and stones.