Certified Diamond Libra Constellation Piercing Earring with Flat Back

Sale price £375.00 Regular price £431.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Wear your zodiac identity in a refined ear stack with this Certified Diamond Libra Constellation Piercing Earring. Six round diamonds trace the Libra constellation in a compact celestial design made for helix, cartilage, and upper-lobe piercings. Sold singly with left- and right-ear options, it makes a personal choice for everyday styling or a thoughtful birthday gift for someone born under Libra.

0.29 Carat Diamond Libra Constellation Earring with Flat Back

The constellation design is set with six round diamonds totaling approximately 0.29 carat, with each stone measuring about 2 x 2 mm. The diamonds have brilliant cuts and are secured in prong settings. Buyers can choose natural diamonds in HI-SI quality or lab grown diamonds in EF-VS quality. Gold options include 10K, 14K, and 18K yellow or white gold, while flat-back post lengths are available from 4.5 mm to 7.5 mm. The earring has an approximate weight of 0.90 gram and is sold as a single piece.

What Makes This Diamond Libra Piercing Earring Special

  • Libra constellation motif created with six round diamonds.
  • Approximately 0.29 carat total diamond weight.
  • Round diamonds measuring approximately 2 x 2 mm each.
  • Brilliant-cut stones secured in prong settings.
  • Choice of HI-SI natural diamonds or EF-VS lab grown diamonds.
  • Available in 10K, 14K, and 18K yellow or white gold.
  • Flat-back closure with post lengths from 4.5 mm to 7.5 mm.
  • Designed for helix, cartilage, or upper-lobe piercing placement.
  • Available for the left or right ear and sold singly.

Meaning Behind the Libra Constellation Piercing Design

The six-stone arrangement transforms the Libra constellation into a subtle piece of personal jewelry rather than a traditional zodiac symbol. Its compact profile makes the meaning feel intimate, while the diamond points recreate the celestial pattern with noticeable sparkle. It is a strong choice for Libra birthdays, personal milestones, zodiac gifting, or anyone who enjoys building an ear stack around jewelry with individual significance.

Certified Diamond Piercing Earring Craftsmanship & Authenticity

Rosec Jewels crafts the earring with attention to diamond placement, prong security, and refined finishing. Rosec Jewels states that its jewelry is supplied with authenticity certification for added purchase confidence. Each piece also goes through stone inspection, setting security review, and finishing inspection before dispatch, with care guidance provided to support proper long-term wear.

Styling a Diamond Libra Helix and Cartilage Earring

The constellation shape brings multiple points of diamond sparkle into one compact piercing design without requiring several separate studs. Wear it alone as a celestial accent or combine it with hoops, simple studs, or other minimal piercing jewelry for a layered ear stack. The choice of yellow or white gold makes it easy to coordinate with warm- or cool-toned jewelry, while the selectable flat-back length helps tailor the piece to different piercing placements.

Product Information
SKU SHP-BODYJ082410122
Metal Weight 1.00 gm (Approximate)
Total Stone Weight 0.29 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 6 Pieces
Total Weight 0.29 Carat (Approximate)
Dimension(approx) Round-2X2 mm-6 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

FAQs About: Certified Diamond Libra Constellation Piercing Earring

How many diamonds are in the Libra constellation piercing earring?

The earring contains six round diamonds with an approximate combined weight of 0.29 carat. Each stone measures about 2 x 2 mm and has a brilliant cut with a prong setting.

Can I choose natural or lab grown diamonds for this Libra earring?

Yes. The design is offered with natural diamonds graded HI-SI or lab grown diamonds graded EF-VS, allowing you to choose the diamond type and quality option that best suits your preference.

What gold options are available for this diamond zodiac piercing?

The Libra constellation earring is available in 10K, 14K, and 18K yellow gold or white gold, giving you a choice of warm or cool precious-metal tones.

What flat-back post lengths are available?

Flat-back post lengths are offered in 4.5 mm, 5.0 mm, 5.5 mm, 6.0 mm, 6.5 mm, 7.0 mm, and 7.5 mm options. The earring is also available for either the left or right ear and is sold singly.

Where can I wear the Libra constellation piercing earring?

The celestial diamond earring is designed for helix, cartilage, and upper-lobe piercings. Its compact constellation shape also works well as part of a stacked ear look with hoops or smaller studs.

Does this certified diamond piercing earring come with authenticity documentation?

Yes. Rosec Jewels provides authenticity certification with its jewelry for added product confidence. The jewelry also goes through stone inspection, setting security review, and finishing inspection before dispatch.

How should I care for a diamond Libra piercing earring?

Clean the earring gently with mild soap, lukewarm water, and a soft brush or cloth, then dry it carefully. Avoid harsh chemicals and abrasive surfaces, check the flat back and prong settings periodically, and store the earring separately when it is not being worn.