Certified Diamond Paw Cartilage Earring

Sale price £347.00 Regular price £399.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Complete your everyday looks with a sweet reminder of your pet when you wear this Diamond Dog Paw Earring. Embellished with brilliant cut diamonds secured in pave setting on a cute paw print motif. The Flat Back Closure ensures a secure fit, making this cute Piercing Stud Earring suitable for Tragus, Cartilage, Helix, or Upper Lobe Piercings. Let your style blossom as you showcase this Paw Print Earring, leaving a lasting impression with its radiant sparkle. Take your fashion game to new heights by pairing this Diamond Cartilage Earring with other ear jewelry, curating a dazzling ensemble thats bound to steal the spotlight at any gathering. Offering a symbolic design, it creates a stunning display of sparkle, showcasing the beauty of Certified Diamonds enhancing its brilliance. The beauty and elegance of this Cartilage Stud Earring is purely designed to be noticed, expressing style and personality. Our experienced creators and artisans bring the best design concepts made with diamonds. It is handcrafted with a thought of timelessly trending so that one can pair this with casual to statement looks.

Product Information
SKU SHP-BODYJ052310038
Metal Weight 0.80 gm (Approximate)
Total Stone Weight 0.11 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 27 Pieces
Total Weight 0.11 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-22 Pcs
Round-0.90X0.90 mm-5 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade SI
View More