Certified Diamond Sideway Cross Bracelet

Sale price £834.00 Regular price £959.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Carry a meaningful expression of faith close at hand with this Certified Diamond Sideway Cross Bracelet. A slender cross sits horizontally within the chain and is illuminated by a line of round brilliant diamonds, giving the symbolic design a refined sparkle without overwhelming the wrist. Offered with lab-grown EF-VS or natural HI-SI diamond quality options, this diamond sideways cross bracelet is a thoughtful choice for a birthday, personal keepsake, faith-centered celebration, or meaningful jewelry gift.

0.26 Carat Round Brilliant Diamond Sideways Cross Bracelet

The cross is set with 26 round brilliant diamonds measuring approximately 1.10 x 1.10 mm each and totaling approximately 0.26 carat. Pavé setting brings the individual stones together in a closely spaced trail of light, while the sideways placement allows the cross to become an integrated part of the chain rather than a hanging charm. The confirmed metal option is 92.5 sterling silver, complemented by a lobster clasp for a secure, streamlined finish.

Pavé Diamond Cross Bracelet Details That Stand Out

  • 26 round brilliant diamonds with an approximate total stone weight of 0.26 carat.
  • Approximately 1.10 x 1.10 mm round diamonds arranged in a pavé setting.
  • Choice of lab-grown EF-VS or natural HI-SI diamond quality.
  • Sideways cross motif incorporated directly into the chain for a clean, minimal profile.
  • Approximately 10.5 mm width and 1.5 mm height, with an approximate metal weight of 3.30 grams.
  • Confirmed in 92.5 sterling silver and selected yellow or white gold options in 10K, 14K, and 18K construction and a lobster clasp designed for secure fastening.

Why Choose a Sideways Diamond Cross Bracelet

The horizontal cross gives a familiar faith symbol a more understated way to be worn, while the pavé-set round diamonds add definition and brilliance along its clean lines. Rather than relying on a single focal stone, the arrangement creates an even shimmer across the motif. Its symbolism of faith, spirituality, and divine connection makes the design personally meaningful, while its restrained scale works equally well as a private reminder, a cherished gift, or part of a layered bracelet collection.

Certified Diamond Bracelet Authenticity & Craftsmanship

Rosec Jewels crafts the bracelet with attention to stone placement, setting security, clasp function, and refined finishing. Before dispatch, the piece goes through stone inspection, a setting-security review, and a finishing inspection to help ensure the diamonds and overall construction meet the intended standard. A Certificate of Authenticity accompanies the jewelry for added product confidence, together with care guidance to help preserve the sparkle of the diamonds and the finish of the sterling silver.

Sterling Silver Diamond Cross Bracelet for Stacking & Gifting

The slim chain and sideways motif make this sterling silver diamond cross bracelet easy to wear alone when you want the symbolism to remain the focus or alongside other fine bracelets for a layered look. Its low-key sparkle transitions naturally between casual clothing, workwear, and dressier occasions, while the cross gives the piece added significance as a birthday gift, faith-inspired keepsake, or personal reminder. The lobster clasp keeps the silhouette neat and practical for regular wear with appropriate jewelry care.

Product Information
SKU SHP-BRACELET0621114565
Width 10.5 mm
Height 1.5 mm
Metal Weight 3.30 gm (Approximate)
Total Stone Weight 0.26 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 26 Pieces
Total Weight 0.26 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-26 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade SI
View More

Product Parent Collection Handle
diamond-bracelets

FAQs About: Certified Diamond Sideway Cross Bracelet

What diamonds are used in the Certified Diamond Sideway Cross Bracelet?

The bracelet is offered with lab-grown EF-VS or natural HI-SI diamond quality options. Its cross is embellished with 26 round brilliant diamonds measuring approximately 1.10 x 1.10 mm each, with an approximate combined stone weight of 0.26 carat.

What does the sideways diamond cross bracelet symbolize?

The sideways cross carries associations with faith, spirituality, and divine connection. Integrating the cross horizontally into the chain gives that symbolism a subtle, wearable form that can serve as a personal reminder or a meaningful gift.

How are the round diamonds set in the cross bracelet?

The 26 round brilliant diamonds are arranged in a pavé setting across the cross. This closely spaced setting creates a continuous line of sparkle and emphasizes the clean shape of the sideways cross rather than creating a solitaire-style focal point.

What metal option is available for this diamond cross bracelet?

The confirmed metal option for this bracelet in 92.5 sterling silver and selected yellow or white gold options in 10K, 14K, and 18K. The diamond-set sideways cross is connected to a fine chain and completed with a lobster clasp.

Does the Certified Diamond Sideway Cross Bracelet come with an authenticity certificate?

Yes. Rosec Jewels provides a Certificate of Authenticity with the jewelry. The bracelet also undergoes stone inspection, setting-security review, and finishing inspection before dispatch.

Is this diamond sideways cross bracelet suitable for daily wear and stacking?

Its minimalist chain design and compact sideways cross make it well suited to regular wear with proper care. It can be worn alone for a restrained faith-inspired look or stacked with other fine bracelets, while the lobster clasp provides secure fastening.

How should I care for a sterling silver diamond cross bracelet?

Keep the bracelet away from harsh chemicals, abrasive cleaners, and heavy impact. Wipe it gently with a soft jewelry cloth after wear, store it separately when not in use, and periodically check the clasp and diamond settings to help maintain its finish and sparkle.