Certified Lab Grown Diamond and Emerald Wedding Tennis Bracelet

Sale price £1,506.00 Regular price £1,731.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Bracelet Length
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

This tennis bracelet combines the brilliance of lab grown diamonds with the rich green color of emeralds, arranged in a refined sequence that highlights contrast and balance. The design offers a continuous line of gemstones that encircle the wrist with a consistent and elegant rhythm.

The pairing of diamonds and emeralds creates a distinctive visual harmony, where the brightness of diamonds complements the depth of emerald color, resulting in a bracelet that feels both classic and visually expressive.

Alternating Gemstone Bracelet Design

Tennis bracelets are known for their uniform structure, where gemstones are set in a continuous row to create a smooth and symmetrical look. In this design, alternating gemstones introduce visual variation while preserving the balanced structure that defines the style.

The arrangement enhances both stones by allowing each gemstone to stand out individually while contributing to the overall composition of the bracelet.

Emerald and Diamond Contrast

Emeralds are valued for their distinctive green color, while diamonds are known for their exceptional brilliance. When combined in a single design, the two stones create a contrast that emphasizes both color and light.

This contrast allows the bracelet to maintain elegance while also offering a unique gemstone pairing that differentiates it from traditional single-stone tennis bracelet designs.

Lab Grown Diamond Characteristics

Lab grown diamonds possess the same physical and optical properties as natural diamonds. They are produced in controlled environments rather than being mined from the earth.

These diamonds are created without traditional mining, though the environmental impact can vary depending on production processes and energy sources.

A Timeless Jewelry Style

Tennis bracelets are widely appreciated for their clean structure and continuous gemstone arrangement. Their streamlined design allows them to complement both everyday outfits and more formal attire.

By combining emerald color with diamond brilliance, this bracelet offers a refined interpretation of a classic jewelry style while maintaining versatility and elegance.

Product Information
SKU SHP-BRACELET042510007
Metal Weight 10.00 gm (Approximate)
Total Stone Weight 3.15 Carat (Approximate)
LAB CREATED EMERALD INFORMATION
No.of Stones 42 Pieces
Total Weight 1.68 Carat (Approximate)
Dimension(approx) Round-2X2 mm-42 Pcs
Color Green
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAAA
LAB GROWN DIAMOND INFORMATION
No.of Stones 42 Pieces
Total Weight 1.47 Carat (Approximate)
Dimension(approx) Round-2X2 mm-42 Pcs
Color E-F
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade VS
View More

FAQs About: Certified Lab Grown Diamond and Emerald Wedding Tennis Bracelet

What is a tennis bracelet?
A tennis bracelet is a bracelet style featuring a continuous line of gemstones set closely together, creating a symmetrical and flexible design.
Why combine emeralds and diamonds in a bracelet?
Emeralds provide rich green color while diamonds add brilliance. Together they create visual contrast that enhances the overall appearance of the bracelet.
Are lab grown diamonds real diamonds?
Lab grown diamonds have the same chemical composition and optical properties as natural diamonds but are produced in controlled laboratory environments.
Can a tennis bracelet be worn daily?
Tennis bracelets are commonly worn daily because their flexible structure and balanced gemstone layout make them comfortable and versatile.
What makes emeralds unique in jewelry?
Emeralds are known for their distinctive green color and have been valued in jewelry for centuries because of their vibrant appearance.
Is a gemstone tennis bracelet suitable for formal occasions?
Gemstone tennis bracelets are often worn for formal events because their continuous gemstone design provides elegance and visual balance.