Certified Lab Grown Diamond Infinity Wedding Band Ring

Regular price £1,195.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Modern Symbol of Everlasting Commitment

The Certified Lab Grown Diamond Infinity Wedding Band is designed for those who value meaning as much as beauty. The infinity motif represents continuity and lasting connection, making it a thoughtful choice for a wedding band or anniversary ring. Its balanced proportions allow it to complement engagement rings or stand confidently on its own.

Infinity Design with Refined Structure

The infinity pattern is carefully formed to create a fluid, uninterrupted silhouette. Lab grown diamonds are set within the design to enhance light reflection while maintaining clean lines. The structure is crafted to sit comfortably along the finger, supporting daily wear without compromising elegance.

Lab Grown Diamonds with Certified Quality

Lab grown diamonds offer the same physical and optical properties as mined diamonds and are created without traditional mining. As with all manufactured products, overall environmental impact varies by production and energy source. Their clarity and brilliance make them suitable for everyday jewelry, especially in a band designed to be worn consistently.

High-Level Features

  • Infinity-inspired band design symbolizing continuity and commitment.
  • Set with certified lab grown diamonds for refined sparkle.
  • Designed for stacking or wearing as a standalone wedding band.
  • Complete specifications and metal options are provided in the product detail tables above.
Product Information
SKU SHP-RINGS022510088
Width 10 mm
Height 3 mm
Metal Weight 4.67 gm (Approximate)
Total Stone Weight 0.80 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 100 Pieces
Total Weight 0.80 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-100 Pcs
Color E-F
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade VS
View More

FAQs About: Certified Lab Grown Diamond Infinity Wedding Band Ring

Are the diamonds in this band certified?
Yes, this ring features certified lab grown diamonds. Specific certification details can be found in the product information section.
Can this infinity band be worn every day?
Lab grown diamonds are durable and suitable for daily wear when properly cared for. Regular cleaning and mindful handling help maintain their brilliance.
Can I stack this ring with an engagement ring?
Yes, the infinity band is designed to complement many engagement ring styles. Its balanced profile makes it suitable for stacking or wearing alone.
What metal options are available?
Available metal options are listed on the product page. Please refer to the selection menu and product detail tables for accurate information.
Where can I find carat weight and other specifications?
Detailed specifications, including carat weight and measurements, are provided in the product detail tables above.