Certified Lab Grown Ruby Leaf Chain Bracelet

Regular price £943.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Inspired by the effortless beauty of nature, this Leaf Bracelet brings a fresh, modern twist to a timeless vine leaf motif. Designed with dazzling Pear and Marquise Shaped Lab Grown Ruby stones set in Prong Setting, each gem is carefully arranged to form delicate Leaf patterns that flow gracefully around your wrist. The rich red sparkle of the AAAA Quality Lab Grown Ruby stones captures the warmth of romance and the boldness of confidence, making this Lab Ruby Bracelet a standout piece in any jewelry collection. Its fine detailing gives it an elegant look, while the secure Lobster Clasp Closure ensures a comfortable and reliable fit all day long. Eye-catching, this Chain Bracelet pairs beautifully with both casual outfits and dress ensembles, whether you are heading to brunch, a festive gathering, or a special evening out. Delivered in a signature jewelry box, this Womens Ruby Bracelet (Lab Grown) is ready to gift and perfect for birthdays, anniversaries, Valentines Day or simply as a thoughtful surprise for someone you love.

Product Information
SKU SHP-BRACELET0621104917
Width 11 mm
Height 2 mm
Metal Weight 3.30 gm (Approximate)
Total Stone Weight 1.50 Carat (Approximate)
LAB CREATED RUBY INFORMATION
No.of Stones 6 Pieces
Total Weight 1.50 Carat (Approximate)
Dimension(approx) Marquise-2.50X5.00 mm-5 Pcs
Pear-3X5 mm-1 Pcs
Color Red
Cut Brilliant
Shape Marquise, Pear
Setting Type Prong-Setting
Quality Grade AAAA
View More