Certified Moissanite Beautiful Flower Engagement Ring

Sale price £667.00 Regular price £766.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Nature’s charm meets modern romance in this uniquely Floral Engagement Ring. At the core of this enchanting design is a delicate cluster of prong set round cut moissanites (D-VS1 quality), expertly arranged to form a blooming flower that sparkles from every angle. The floral motif adds a graceful and feminine touch to this Cluster Engagement Ring, capturing the spirit of love in full bloom. Carefully crafted and designed to last, this Moissanite Engagement Ring combines classic elegance with a playful charm, ideal for women who appreciate fine jewelry that feels personal and expressive. The stunning moissanites reflect light beautifully, offering an ethical and sustainable choice without compromising on brilliance. Presented in a delightful jewelry box, it is ready to be given as a gift or cherished as a keepsake that represents a love that continues to grow. Let this Moissanite Flower Ring be a lasting reminder that love, like flowers, thrives with care and intention.

Product Information
SKU SHP-RINGS0821218036
Width 12.6 mm
Height 4.8 mm
Metal Weight 2.80 gm (Approximate)
Center Stone Weight 2.20 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 7 Pieces
Total Weight 2.20 Carat (Approximate)
Dimension(approx) Round-4X4 mm-7 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Claw-Set
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-engagement-rings