Certified Moissanite Cute Key to My Heart Pendant Necklace

0
Regular price £933.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Experience the beauty of love with this stunning Moissanite Pendant Necklace, which represents both love and elegance. It is a meaningful gift for that special someone who holds your heart. This lovely piece features a delicate key design, meticulously crafted and adorned with a dazzling Round Shape Moissanite at its center in Prong Setting, reflecting light with every graceful movement. Surrounding the center stone are three heart motif symbolizes romance and connection, making this Heart and Key Necklace a perfect gift for a loved one or a treasured treat for yourself. The pendant hangs gracefully from a chain, providing timeless elegance that enhances any outfit, whether for a special occasion or casual wear. The Key to My Heart Necklace acts as a heartfelt reminder of the most significant connections in life. It also symbolizes the key to happiness. Its distinctive design will elevate your style and make your neckline shine with its gentle sparkle. This exquisite Moissanite Key Pendant would be a wonderful birthday gift, a Valentine’s Day surprise, or simply a thoughtful gift to show your appreciation for having her in your life.

Product Information
SKU SHP-PENDANT072210073
Length 35 mm
Width 13.2 mm
Height 2.5 mm
Metal Weight 3.80 gm (Approximate)
Total Stone Weight 0.12 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.12 Carat (Approximate)
Dimension(approx) Round-3X3 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-necklaces