Certified Moissanite Infinity Heart Necklace

Sale price £750.00 Regular price £862.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Meaningful Symbol in a Refined Form

The Certified Moissanite Infinity Heart Necklace blends two timeless motifs—an infinity loop and a heart—into a single, balanced design. Created for those who value symbolism with subtle elegance, this necklace offers a thoughtful gift option as well as a personal everyday piece.

Its proportions are designed to feel delicate without appearing minimal, allowing the pendant to rest comfortably along the neckline.

Infinity and Heart Design Structure

The infinity element represents continuity, while the heart form introduces softness and sentiment. Together, they create a pendant that feels both expressive and wearable.

The setting secures the moissanite stones within the framework of the design, allowing light to interact naturally with the surface. Exact construction details, metal types, and dimensions are listed in the product specification tables above.

Certified Moissanite Brilliance

Moissanite is valued for its brightness and durability, making it well suited for jewelry intended for regular wear. Certification information, when included, confirms the authenticity and specifications of the stone as detailed in the official product tables.

As a lab-created gemstone, moissanite is created without traditional mining. Environmental impact varies by production and energy source.

High-Level Features

  • Infinity and heart motif combined in a balanced pendant design.
  • Moissanite stones selected for consistent brilliance.
  • Crafted for everyday wear and meaningful gifting.
  • Complete technical specifications available in the detail tables above.
Product Information
SKU SHP-PENDANT052310112
Length 13.5 mm
Width 20 mm
Metal Weight 3.40 gm (Approximate)
Total Stone Weight 0.27 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 27 Pieces
Total Weight 0.27 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-25 Pcs
Round-1X1 mm-1 Pcs
Round-0.80X0.80 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-necklaces

FAQs about: Certified Moissanite Infinity Heart Necklace

What does certification mean for this necklace?
Certification confirms the authenticity and listed specifications of the moissanite stone. Specific certification details are provided in the product information tables above.
Is this necklace suitable for daily wear?
Moissanite is known for its durability and resistance to scratching, making it appropriate for regular wear when handled and stored with care.
What metal options are available?
Available metal types and finishes are listed in the product selection section and specification tables above. Please review those details for current options.
Is the chain included with the pendant?
The product listing clarifies what is included with your purchase. Please refer to the product details section to confirm whether the chain is included.
How can I verify the stone size and measurements?
The official carat weight, dimensions, and other technical specifications are provided in the product detail tables above.