Certified Moissanite Leaf Stud Earrings with Screw Back

Sale price £409.00 Regular price £471.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

A timeless sparkle meets nature inspired charm in these Moissanite Stud Earrings, designed to bring effortless elegance to your everyday look. Crafted in a Leaf motif, these Fine Earrings are beautifully adorned with shimmering Round Moissanite stones that reflect light from every angle. At the center, a stunning 3X5 mm Pear Shaped Moissanite is placed at a gentle tilt, creating a unique focal point that adds brilliance to the design. The graceful arrangement of stones gives the earrings a soft feel while still delivering a modern, luxurious shine. Designed with a secure Screw Back Closure, these Leaf Earrings stay comfortably in place, making them perfect for all-day wear without worry. Whether you are dressing up for a celebration, heading out for a casual day or simply adding a touch of sparkle to your daily outfit, these Moissanite Diamond Earrings blend beautifully with any style. Their elegant yet versatile design makes them a thoughtful gift for birthdays, anniversaries or special moments with loved ones. Presented in a stylish jewelry box, these Moissanite Ear Studs are ready to surprise someone special or to become a treasured addition to your own jewelry collection.

Product Information
SKU SHP-EARRINGS072210047
Length 11.3 mm
Width 5.5 mm
Metal Weight 1.60 gm (Approximate)
Total Stone Weight 0.49 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 36 Pieces
Total Weight 0.49 Carat (Approximate)
Dimension(approx) Pear-3X5 mm-2 Pcs
Round-0.80X0.80 mm-12 Pcs
Round-0.90X0.90 mm-22 Pcs
Color White
Cut Brilliant
Shape Pear, Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-earrings