Certified Opalescent Diamond Flower Engagement Ring with Natural Diamonds

Sale price £787.00 Regular price £884.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Floral Design with Luminous Character

This certified opalescent diamond flower engagement ring is created for those who are drawn to romantic silhouettes and soft, luminous sparkle. The floral-inspired arrangement gives the ring a graceful presence, making it a meaningful symbol of growth and lasting commitment.

Its distinctive composition offers an artistic alternative to traditional single-stone engagement styles.

Flower Motif with Natural Diamond Accents

The flower-inspired setting brings together carefully arranged diamonds to create a blooming effect at the center. Natural diamond accents enhance the design with refined brilliance, adding dimension and light from multiple angles.

This structured yet delicate layout ensures the ring feels detailed without appearing heavy.

The Appeal of Opalescent Brilliance

Opalescent diamonds are admired for their soft glow and subtle light play, offering a distinctive visual character. Combined with natural diamonds, the overall effect is luminous and expressive while remaining elegant.

The certified nature of the piece provides added confidence in its authenticity and quality.

Crafted for a Memorable Proposal

With its floral composition and balanced proportions, this engagement ring is designed to celebrate a meaningful milestone. It transitions beautifully from proposal to everyday wear when handled with care, maintaining its refined and romantic aesthetic.

Product Information
SKU SHP-RINGS0821221702
Width 3.8 mm
Height 7 mm
Metal Weight 2.52 gm (Approximate)
Total Stone Weight 0.57 Carat (Approximate)
ETHIOPIAN OPAL INFORMATION
No.of Stones 1 Pieces
Total Weight 0.25 Carat (Approximate)
Dimension(approx) Round-4X4 mm-1 Pcs
Color Rainbow
Cut Brilliant
Shape Round
Setting Type Claw-Set
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 16 Pieces
Total Weight 0.32 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-12 Pcs
Marquise-1.50X3.00 mm-4 Pcs
Color HI
Cut Brilliant
Shape Round, Marquise
Setting Type Claw-Set
Quality Grade SI
View More

Product Parent Collection Handle
opal-rings

FAQs About: Opalescent Diamond Flower Engagement Ring

What defines a flower-style engagement ring?
A flower-style ring arranges stones in a petal-like pattern around a central focal point, creating a blooming effect that symbolizes romance and growth.
What is meant by opalescent diamond?
Opalescent diamonds display a softer, glowing appearance that gives the center a luminous character rather than sharp brilliance alone.
Are the accent stones natural diamonds?
Yes, the design incorporates natural diamonds to enhance sparkle and provide balanced brilliance around the floral center.
Is this ring suitable for everyday engagement wear?
With mindful care and regular maintenance, it can be worn daily. Proper storage and gentle handling help preserve its detailing and finish.
Who is this engagement ring best suited for?
It is ideal for someone who appreciates romantic floral motifs and desires a luminous, detail-oriented engagement design.