Certified Real Diamond Snowflake Earrings with Screw Back

Sale price £883.00 Regular price £970.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Turn heads with the enchanting sparkle of these Diamond Snowflake Earrings, a pair designed to capture the magic of winter in a timeless, elegant style. Each earring features a delicate Snowflake motif, beautifully adorned with shimmering Diamond stones, creating a radiant burst of light with every movement. The secure Screw Back Closure ensures they stay comfortably in place, allowing you to wear them all day with confidence and ease. Perfect to wear with cozy winter outfits, chic evening dresses or even a simple everyday look, these Diamond Stud Earrings add a touch of brilliance that instantly elevates your style. Their soft glow and detailing make them an effortless way to bring a hint of seasonal charm to any moment. Arriving in a lovely jewelry box, these Snowflake Earrings are ready to gift and guaranteed to make someone smile. Whether you are searching for a thoughtful holiday surprise, a heartfelt birthday present, or a meaningful gift, these Diamond Studs make every occasion feel a little more magical. Delicate, bright and beautifully crafted, these Real Diamond Earrings are the perfect choice for anyone who loves jewelry that tells a story.

Product Information
SKU SHP-EARRINGS032210252
Length 10.3 mm
Width 10.2 mm
Height 3.5 mm
Metal Weight 1.90 gm (Approximate)
Total Stone Weight 0.66 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 50 Pieces
Total Weight 0.66 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-48 Pcs
Round-2.40X2.40 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
stud-earrings