Certified Round Shape Blue Sapphire Cluster Flower Ring

Sale price £659.00 Regular price £724.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Floral Ring with Elegant Character

This blue sapphire cluster flower ring is designed for those who appreciate nature-inspired details with a refined finish. The floral motif creates a soft and graceful appearance, making it a distinctive piece for both everyday wear and special occasions.

Its balanced structure allows it to stand out while remaining easy to style.

Cluster Flower Design with Visual Depth

The cluster arrangement forms a flower-like pattern, bringing dimension and texture to the ring. Each stone is placed to enhance the overall symmetry, creating a cohesive and well-structured design.

This setting enhances the visual presence of the ring while maintaining a refined look.

Blue Sapphire Appeal

Blue sapphire is known for its deep and rich color, offering a classic yet striking appearance. Its tone adds depth to the design, making it a versatile choice for different occasions.

The gemstone serves as a focal point while complementing the overall floral composition.

Comfortable and Versatile Wear

Crafted for ease of wear, this ring provides a comfortable fit suitable for extended use. Its design allows it to sit securely on the finger while maintaining a lightweight feel.

It can be worn as a standalone piece or paired with other rings for a layered look.

Product Information
SKU SHP-RINGS0821190361
Width 11.8 mm
Height 4.5 mm
Weight 3.20 gm (Approximate)
BLUE SAPPHIRE INFORMATION
No.of Stones 7 Pieces
Total Weight 1.26 Carat (Approximate)
Dimension(approx) Round-3X3 mm-7 Pcs
Color Blue
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
View More

Product Parent Collection Handle
blue-sapphire-rings

FAQs About: 1 Ct Round Shape Blue Sapphire Cluster Flower Ring

Is this ring suitable for everyday wear?
Yes, its comfortable design makes it suitable for regular use.
What makes the cluster flower design unique?
The cluster arrangement creates a floral-inspired pattern that adds dimension and visual interest.
Why choose blue sapphire for a ring?
Blue sapphire is valued for its rich color and timeless appeal, making it a versatile gemstone.
Can this ring be stacked with other rings?
Yes, it can be paired with other rings to create a layered style.
Does the design make the ring look larger?
The cluster design enhances visual presence, giving the ring a fuller appearance.
How should this ring be cared for?
Clean gently with a soft cloth and store separately to maintain its finish.