Designer Freshwater Pearl Bridal Dangle Earrings with Diamond

Regular price £1,261.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Crafted to captivate hearts, these Pearl Dangle Earrings bring a touch of poetic beauty to every moment. Each earring showcases a radiant 10 mm Freshwater Pearl that gently sways beneath an exquisite Lotus Flower motif, carefully detailed and adorned with petite Diamond stones for a graceful sparkle. The design feels both modern and timeless, perfect for brides seeking elegance with a meaningful, nature-inspired twist. Finished with a secure Screw Back Closure, these Pearl Diamond Earrings offer comfort and confidence from ceremony to celebration, so you can move freely without a worry. Their delicate glow and refined craftsmanship make them a lovely choice for wedding days and also for anniversaries, date nights or any occasion that calls for something truly special. Beautifully presented in a signature jewelry box, these Freshwater Cultured Pearl Earrings are also a thoughtful gift for someone who loves fine details and classic charm. Whether you are treating yourself or surprising someone dear, this pair promises to become a treasured keepsake filled with elegance, emotion and unforgettable sparkle.

Product Information
SKU SHP-EARRINGS012210225
Length 30.7 mm
Width 9 mm
Metal Weight 2.60 gm (Approximate)
Total Stone Weight 16.79 Carat (Approximate)
FRESHWATER PEARL INFORMATION
No.of Stones 2 Pieces
Total Weight 16.00 Carat (Approximate)
Dimension(approx) Round-10X10 mm-2 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Bead-Set
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 100 Pieces
Total Weight 0.79 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-12 Pcs
Round-0.90X0.90 mm-26 Pcs
Round-1.10X1.10 mm-16 Pcs
Round-1.20X1.20 mm-26 Pcs
Round-1.30X1.30 mm-4 Pcs
Round-1X1 mm-16 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Bead-Set
Quality Grade SI
View More

Product Parent Collection Handle
freshwater-pearl-earrings