Diamond Crescent Moon and Star Earring for Helix Piercing

Regular price £351.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Celestial Detail for Curated Ear Styling

This diamond crescent moon and star earring is designed specifically for helix piercing placement, offering a delicate yet expressive accent. The celestial motif creates a symbolic and contemporary look, ideal for those who prefer meaningful fine jewelry in a subtle scale. Its proportions are suited for cartilage styling, whether worn alone or paired with additional studs for a layered ear aesthetic.

Design & Setting Structure

The crescent moon silhouette curves gently around the ear’s contour, while the star element adds visual contrast and dimension. Diamonds are placed to enhance light reflection without overwhelming the compact design. The setting is structured to sit close to the ear, helping maintain balance and minimizing movement during daily wear.

Diamond Characteristics

The earring features natural diamonds selected for their brightness and clarity. Their scale is proportioned to complement cartilage placement, offering refined sparkle in a minimal format. Detailed specifications including stone weight and metal options are provided in the product tables below.

High-Level Features

  • Crescent moon and star motif designed for helix piercing.
  • Diamond accents for controlled brilliance.
  • Compact structure suitable for cartilage placement.
  • Single earring format as specified on the product page.
Product Information
SKU SHP-BODYJ102310041
Metal Weight 0.70 gm (Approximate)
Total Stone Weight 0.05 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 5 Pieces
Total Weight 0.05 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-5 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

FAQs About: Diamond Crescent Moon and Star Helix Earring

Is this earring sold as a single piece?
Yes, this listing is for a single helix earring. Please review the product details section for confirmation.
Is this suitable for helix or cartilage piercing?
Yes, the design and scale are intended for helix piercing placement and curated ear styling.
What type of stones are used in this earring?
This earring features natural diamonds. Complete specifications including stone details are available in the product tables.
Will the earring sit flat on the ear?
The setting is designed to sit close to the ear, helping maintain stability and a refined appearance when worn in the helix position.
What metal options are available?
Available metal selections can be chosen directly on the product page. Refer to the product detail tables for accurate information.