Diamond Infinity Necklace Earrings Set For Women

Regular price £1,460.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Created to celebrate connection that continues beyond a single moment, this diamond infinity necklace and earrings set brings matching sparkle to the neckline and ears. The pendant and stud earrings are shaped in a flowing twin infinity silhouette, giving the set a graceful sense of movement and meaning. Round diamonds trace the design in a delicate pave setting, creating a coordinated jewelry set that feels thoughtful for anniversaries, birthdays, romantic gifting, milestone celebrations, or a polished personal keepsake.

Round Brilliant Pave Set Diamonds Infinity Necklace Earrings Set

This diamond jewelry set includes an infinity pendant with an 18 inch chain and matching infinity stud earrings. A total of 152 round brilliant diamonds are set across the design, with an approximate total diamond weight of 0.96 carat. The flowing infinity form, pave setting, screw back earring closures, and multiple precious metal options make the set a refined choice for meaningful gifting and coordinated styling.

What Makes This Special

The set includes a pendant and matching stud earrings, each crafted in a twin infinity silhouette. The pendant is finished with a simple bail, allowing the infinity design to remain the focal point, while the earrings mirror the pendant and are secured with screw back closures for a snug fit.

The design features 152 round diamonds with an approximate total weight of 0.96 carat. The diamond layout includes 10 stones measuring approximately 0.80 x 0.80 mm, 84 stones measuring approximately 0.90 x 0.90 mm, 42 stones measuring approximately 1.10 x 1.10 mm, 7 stones measuring approximately 1.20 x 1.20 mm, 5 stones measuring approximately 1.30 x 1.30 mm, and 4 stones measuring approximately 1 x 1 mm.

The diamonds are round in shape, brilliant cut, HI color, SI quality grade, and set in a pave setting. The set measures approximately 30 mm in length and 12 mm in width, with an approximate weight of 8.70 gm. Gemstone quality options include lab diamond EF-VS and natural diamond HI-SI, while metal options include 92.5 sterling silver, 10K yellow gold, 10K white gold, 14K yellow gold, 14K white gold, 18K yellow gold, and 18K white gold.

Why Choose This Design

The infinity motif gives the set emotional depth, making it especially suitable for someone who wants jewelry with visible meaning. Its continuous curves symbolize lasting connection, while the matching pendant and earrings create a complete look without needing to search for separate pieces.

The pave setting allows many small diamonds to create a soft, continuous shimmer across the infinity shape. Round brilliant diamonds bring lively sparkle, while the coordinated necklace and earring design makes the set easy to style for both everyday refinement and formal occasions.

Design Meaning

The infinity symbol represents eternal love, continuity, devotion, and connection that remains strong through time. In this set, the twin infinity silhouette adds a romantic sense of balance, making it meaningful for anniversaries, relationship milestones, Mother’s Day, birthdays, or a gift that says the bond is lasting. The matching earrings and pendant turn that symbolism into a complete jewelry story, worn close and remembered often.

Authenticity & Craftsmanship

Each set is carefully crafted with attention to diamond alignment, pave setting security, pendant finishing, screw back earring comfort, and overall polish. Rosec Jewels offers a Certificate of Authenticity with the product, adding confidence to the purchase experience. Before dispatch, every piece goes through stone inspection, setting security review, and finishing inspection to help ensure it is ready to wear or gift. For lasting care, store the necklace and earrings separately, avoid harsh chemicals, and clean gently with a soft cloth after wear.

Style and Wearability

This infinity necklace and earrings set gives the wearer an instantly coordinated look. The pendant rests on an 18 inch chain, while the matching stud earrings add balanced sparkle near the face. The set pairs naturally with diamond rings, simple bracelets, tailored outfits, evening dresses, and soft everyday layers. Worn together, it feels polished and complete; worn separately, each piece keeps the same meaningful infinity character.

Product Information
SKU SHP-PENDANT112031967
Length 30 mm
Width 12 mm
Weight 8.70 gm (Approximate)
Center Stone Weight 0.96 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 152 Pieces
Total Weight 0.96 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-10 Pcs
Round-0.90X0.90 mm-84 Pcs
Round-1.10X1.10 mm-42 Pcs
Round-1.20X1.20 mm-7 Pcs
Round-1.30X1.30 mm-5 Pcs
Round-1X1 mm-4 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade SI
View More

Product Parent Collection Handle
infinity-jewelry

FAQs About: Diamond Infinity Necklace Earrings Set For Women

What makes this diamond infinity jewelry set meaningful as a gift?

The infinity design symbolizes lasting love, connection, and continuity. Because the set includes both a pendant and matching stud earrings, it makes a thoughtful gift for anniversaries, birthdays, Mother’s Day, romantic milestones, or personal celebrations.

What pieces are included in this jewelry set?

The set includes an infinity pendant necklace with an 18 inch chain and matching infinity stud earrings. The earrings are finished with screw back closures for a secure fit.

How many diamonds are used in this infinity necklace and earrings set?

The design includes 152 round diamonds with an approximate total weight of 0.96 carat. The stones are arranged across the pendant and matching earrings in a pave setting.

What cut, color, and quality are listed for the diamonds?

The diamonds are round in shape with brilliant cut faceting. They are listed as HI color and SI quality grade, with gemstone quality options available in lab diamond EF-VS and natural diamond HI-SI.

What setting style is used in this diamond jewelry set?

The diamonds are set in a pave setting. This setting style creates a continuous trail of small diamonds across the infinity design, giving the pendant and earrings a refined, shimmering finish.

What metal options are available for this set?

This design is available in 92.5 sterling silver, 10K yellow gold, 10K white gold, 14K yellow gold, 14K white gold, 18K yellow gold, and 18K white gold, allowing buyers to choose the metal tone and purity that best suits their style.

How should I care for this diamond infinity necklace and earrings set?

Store the necklace and earrings separately to help prevent scratches and tangling, avoid harsh chemicals, and wipe each piece gently with a soft cloth after wear. For deeper cleaning, use mild soap, lukewarm water, and a soft brush, then dry carefully before storing.