Diamond Infinity Pendant Necklace For Women

Regular price £829.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Timeless Symbol of Infinity

The diamond infinity pendant necklace for women is designed for those who appreciate meaningful jewelry with enduring style. The infinity motif represents continuity and lasting connection, making it suitable for everyday wear or as a thoughtful gift. Its balanced proportions allow it to rest comfortably along the neckline, complementing both casual and formal attire.

Refined Design & Setting

The infinity shape is carefully structured to maintain a smooth, flowing outline. Diamond accents are arranged along the curves to enhance light reflection while preserving the clarity of the symbol. This approach ensures the pendant remains elegant and wearable without appearing overly ornate.

Natural Diamond Brilliance

Crafted with natural diamonds, the pendant delivers subtle sparkle suited for daily wear. Diamonds are valued for their durability and enduring appeal, making them a practical choice for a piece intended to be worn regularly. As with all fine jewelry, periodic care helps maintain their appearance over time.

High-Level Features

  • Infinity-inspired silhouette symbolizing continuity.
  • Diamond accents for refined brilliance.
  • Designed for everyday styling and gifting.
  • Available in multiple precious metal options.
Product Information
SKU SHP-PENDANT022151162
Length 8.5 mm
Width 19 mm
Metal Weight 3.10 gm (Approximate)
Total Stone Weight 0.54 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 8 Pieces
Total Weight 0.54 Carat (Approximate)
Dimension(approx) Round-2.80X2.80 mm-3 Pcs
Round-2.40X2.40 mm-1 Pcs
Round-2.30X2.30 mm-1 Pcs
Round-2X2 mm-1 Pcs
Round-1.80X1.80 mm-1 Pcs
Round-1.50X1.50 mm-1 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
diamond-necklaces

FAQs About: Diamond Infinity Pendant Necklace for Women

Are the diamonds in this pendant natural?
The product details specify natural diamonds. Please refer to the product specification tables for complete diamond information.
Is this necklace suitable for everyday wear?
Yes. The infinity design and diamond setting are suitable for regular wear when properly cared for.
What does the infinity symbol represent?
The infinity symbol commonly represents eternity, continuity, and lasting connection, making it meaningful for gifting.
What metal options are available?
Available metal options are shown in the product selection menu and detailed in the specification tables on the page.
How should I care for this pendant?
Clean gently with mild soap and lukewarm water using a soft brush. Store separately to help maintain its finish and prevent surface scratches.
Is this necklace suitable as a gift?
The symbolic design and versatile style make it appropriate for birthdays, anniversaries, and meaningful occasions.