Freshwater Pearl Solitaire Pendant with Leaf

Sale price £688.00 Regular price £773.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Freshwater Pearl Solitaire Pendant with Leaf

The Freshwater Pearl Solitaire Pendant with Leaf is designed for those who appreciate understated elegance with a nature-inspired touch. A luminous freshwater pearl forms the centerpiece, complemented by a delicate leaf motif that adds soft movement and detail. This pendant offers a refined way to wear classic pearl beauty in a contemporary silhouette.

Design & Setting

The solitaire style highlights the natural luster of the pearl, allowing it to remain the visual focus. The leaf element introduces an organic accent that frames the pearl without overpowering it. This thoughtful balance creates a pendant that feels graceful, versatile, and suitable for both everyday wear and special occasions.

About Freshwater Pearl

Freshwater pearls are valued for their soft glow and natural surface character. Each pearl may display slight variations in shape and luster, making every piece subtly unique. Pearls are best worn with care and stored properly to preserve their surface and shine over time.

Key Highlights

  • Freshwater pearl: natural luster with gentle radiance.
  • Solitaire style: clean design that centers attention on the pearl.
  • Leaf detail: nature-inspired accent for added elegance.
  • Versatile pendant: suitable for daily wear or gifting.
Product Information
SKU SHP-PENDANT012210067
Length 15 mm
Width 10 mm
Metal Weight 2.70 gm (Approximate)
Total Stone Weight 8.00 Carat (Approximate)
FRESHWATER PEARL INFORMATION
No.of Stones 1 Pieces
Total Weight 8.00 Carat (Approximate)
Dimension(approx) Round-10X10 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Bead-Set
Quality Grade AAA
View More

Product Parent Collection Handle
freshwater-pearl-necklaces
Are freshwater pearls natural?
Freshwater pearls are cultured in freshwater environments and are genuine pearls formed with human assistance. Each pearl develops its own natural luster and surface characteristics.
Will each pearl look identical?
Pearls may vary slightly in shape, surface texture, and luster, giving each pendant a subtle individuality.
Is this pendant suitable for everyday wear?
The pendant can be worn daily, though pearls benefit from mindful care and gentle cleaning to maintain their appearance.
What does the leaf detail represent?
The leaf motif adds a nature-inspired element to the design, symbolizing growth and elegance while enhancing the pendant’s visual appeal.
Is this pendant a good gift option?
A pearl pendant is a timeless gift choice, suitable for milestones, celebrations, or meaningful everyday wear.