Garnet Infinity Necklace and Earrings Set for Women

Sale price £1,023.00 Regular price £1,149.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Celebrate a lasting connection with this Garnet Infinity Necklace and Earrings Set. Three rich red garnets sit within coordinating infinity-inspired designs, bringing a meaningful sense of continuity to the matching pendant and earrings. With its solitaire-focused styling, this garnet jewelry set makes a thoughtful choice for anniversaries, January birthstone gifting, romantic milestones, or a coordinated finishing touch for special occasions.

2.98 Carat Round Garnet Infinity Necklace and Earrings Set

The set contains three round garnets with an approximate combined weight of 2.98 carats. One gemstone measures approximately 8 x 8 mm and two measure about 4 x 4 mm, each displaying a red color, brilliant cut, AAA quality, and a three-prong setting. Crafted in 92.5 sterling silver with an approximate metal weight of 4.50 grams, the pendant measures about 17.5 mm long and 9.5 mm wide and is accompanied by an 18-inch chain.

What Makes This Garnet Infinity Jewelry Set Special

  • Matching infinity pendant and earrings for a coordinated jewelry look.
  • Three round red garnets totaling approximately 2.98 carats.
  • One approximately 8 x 8 mm garnet and two approximately 4 x 4 mm garnets.
  • Brilliant-cut stones with AAA quality.
  • Three-prong settings keep the solitaire garnets clearly defined.
  • Infinity motif represents continuity and an enduring connection.
  • Crafted in 92.5 sterling silver and selected yellow or white gold options in 10K, 14K, and 18K with an approximate metal weight of 4.50 grams.
  • Necklace comes with an 18-inch chain.

Meaning Behind the Garnet Infinity Necklace and Earrings

The infinity form is closely associated with lasting bonds and connection, giving this matching garnet set an emotional purpose beyond its coordinated look. Each solitaire garnet adds a vivid red focal point without overwhelming the flowing motif. The combination works especially well for anniversary gifting, romantic celebrations, January birthdays, or marking a relationship milestone with jewelry that carries a clear symbolic message.

Garnet Jewelry Set Authenticity & Craftsmanship

Rosec Jewels crafts this garnet necklace and earrings set with attention to gemstone placement, secure settings, balanced proportions, and refined finishing. The jewelry comes with a Certificate of Authenticity for added purchase confidence. Each piece also goes through stone inspection, setting security review, and finishing inspection before dispatch, with care guidance provided to help maintain the garnets and sterling silver finish.

Styling the Garnet Infinity Necklace and Earrings Set

Worn together, the matching pendant and earrings create a cohesive red-gemstone look, while each piece can also be styled separately when a lighter accent is preferred. The 18-inch chain positions the infinity pendant neatly at the neckline, and the sterling silver setting creates a bright contrast around the red garnets. The set pairs naturally with eveningwear, celebration outfits, silver-toned jewelry, and January birthstone gifts.

Product Information
SKU SHP-PENDANT042167807
Length 17.5 mm
Width 9.5 mm
Metal Weight 4.50 gm (Approximate)
Total Stone Weight 2.98 Carat (Approximate)
GARNET INFORMATION
No.of Stones 3 Pieces
Total Weight 2.98 Carat (Approximate)
Dimension(approx) Round-4X4 mm-2 Pcs
Round-8X8 mm-1 Pcs
Color Red
Cut Brilliant
Shape Round
Setting Type 3-Prong-Setting
Quality Grade AAA
View More

Product Parent Collection Handle
garnet-necklaces

FAQs About: Garnet Infinity Necklace and Earrings Set

How many garnets are included in this infinity necklace and earrings set?

The set contains three round garnets with an approximate combined weight of 2.98 carats. One gemstone measures about 8 x 8 mm and two measure approximately 4 x 4 mm.

What cut and quality are the garnets in this jewelry set?

The red garnets are round in shape, brilliant cut, and graded AAA quality. Each gemstone is secured in a three-prong setting.

What does the infinity design symbolize?

The infinity motif represents continuity and a bond without a defined beginning or end, making the set especially meaningful for romantic partners, anniversaries, and relationship milestones.

Does the garnet infinity necklace include a chain?

Yes. The necklace is supplied with an 18-inch chain, creating a ready-to-wear coordinated set with the matching garnet earrings.

What metal is used for the garnet necklace and earrings set?

The set is crafted in 92.5 sterling silver and selected yellow or white gold options in 10K, 14K, and 18K and has an approximate metal weight of 4.50 grams.

Does this garnet jewelry set come with a Certificate of Authenticity?

Yes. The Garnet Infinity Necklace and Earrings Set comes with a Certificate of Authenticity, providing added confidence in the jewelry and its stated gemstone details.

How should I care for a garnet necklace and earrings set?

Clean the jewelry gently with mild soap, lukewarm water, and a soft cloth, then dry it carefully. Avoid harsh chemicals, abrasive surfaces, and strong impacts, and store the necklace and earrings separately when not worn to help protect the gemstones and metal finish.