Genuine Black Onyx and Diamond Heart Promise Ring

Regular price £596.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Symbol of Commitment with Bold Contrast

This genuine black onyx and diamond heart promise ring is designed to represent devotion with a distinctive edge. The heart motif expresses sentiment, while the deep black onyx center introduces a bold and contemporary character.

Accented with diamonds, the design balances romance and contrast in a refined, wearable form.

Heart Design with Diamond Accents

The heart silhouette gives the ring emotional meaning, making it especially suited as a promise ring or meaningful gift. Its defined curves create a recognizable yet elegant profile.

Diamond accents add light and dimension, softening the intensity of the onyx and enhancing the overall brilliance of the design.

The Appeal of Black Onyx

Black onyx is valued for its smooth surface and uniform color. Its polished finish offers a sleek backdrop that highlights surrounding details.

With mindful wear and care, onyx can be enjoyed regularly while maintaining its surface quality and visual depth.

A Meaningful Promise Ring

This ring is ideal for someone who appreciates symbolic design paired with modern contrast. Whether given as a promise, commitment, or heartfelt gift, it offers a blend of sentiment and individuality.

Product Information
SKU SHP-RINGS082216459
Width 4 mm
Height 6.5 mm
Metal Weight 1.80 gm (Approximate)
Total Stone Weight 0.30 Carat (Approximate)
BLACK ONYX INFORMATION
No.of Stones 1 Pieces
Total Weight 0.25 Carat (Approximate)
Dimension(approx) Heart-4X4 mm-1 Pcs
Color Black
Cut Brilliant
Shape Heart
Setting Type Designer-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 12 Pieces
Total Weight 0.05 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-12 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Designer-Setting
Quality Grade SI
View More

Product Parent Collection Handle
black-onyx-rings

FAQs About: Black Onyx Diamond Heart Ring

What does a heart promise ring symbolize?
A heart promise ring typically represents commitment, affection, or a meaningful bond between two people without necessarily signifying engagement.
Is black onyx suitable for daily wear?
Black onyx can be worn regularly with care. Avoiding impact and harsh cleaning products helps preserve its polished finish.
How do the diamond accents enhance the design?
The diamond accents introduce brightness and contrast, highlighting the heart shape while adding subtle sparkle to the overall look.
Is this ring appropriate as a gift?
Yes, its heart motif and balanced design make it a thoughtful option for anniversaries, milestones, or personal promises.
Who would appreciate this ring style most?
This ring is well suited for someone who values symbolic jewelry with a bold center stone and refined diamond detailing.