Genuine Black Onyx and Diamond Heart Wedding Band

Regular price £1,124.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Black Onyx and Diamond Heart Wedding Band

The Genuine Black Onyx and Diamond Heart Wedding Band brings together symbolic design and contrasting gemstones in a refined ring style. The heart motif represents commitment and affection, creating a meaningful design element within the band. The combination of dark onyx and bright diamonds produces a balanced visual contrast that draws attention to the details of the ring.

Heart Motif Design

The heart shape is widely recognized as a symbol of love and emotional connection, making it a natural choice for wedding jewelry. Incorporated into the band, the heart design adds a distinctive visual element while maintaining a smooth and cohesive structure. The motif offers both decorative appeal and symbolic meaning within the overall ring design.

Black Onyx and Diamond Combination

Black onyx is known for its deep, rich color and polished surface that creates a strong visual presence in jewelry. When paired with diamonds, the contrast between dark and bright gemstones highlights the individual characteristics of each stone. This combination adds depth and elegance while enhancing the design’s overall aesthetic balance.

A Symbolic Wedding Band

This wedding band combines meaningful symbolism with refined gemstone detailing. The heart design paired with black onyx and diamonds results in a ring that reflects both emotional significance and distinctive style, making it a memorable piece of wedding jewelry.

Product Information
SKU SHP-RINGS032219904
Metal Weight 3.80 gm (Approximate)
Total Stone Weight 2.61 Carat (Approximate)
BLACK ONYX INFORMATION
No.of Stones 9 Pieces
Total Weight 2.25 Carat (Approximate)
Dimension(approx) Heart-4X4 mm-9 Pcs
Color Black
Cut Brilliant
Shape Heart
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 90 Pieces
Total Weight 0.36 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-90 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
black-onyx-women-wedding-bands
What is black onyx in jewelry?
Black onyx is a gemstone known for its deep black color and smooth polished surface, often used in jewelry designs for its bold and elegant appearance.
What does a heart design symbolize in jewelry?
A heart motif in jewelry traditionally represents love, emotional connection, and commitment, making it a meaningful element in wedding and engagement designs.
Can black onyx be used in wedding bands?
Yes, black onyx is sometimes used in wedding bands for its distinctive color and ability to create contrast when paired with other gemstones such as diamonds.
What is a gemstone wedding band?
A gemstone wedding band features decorative gemstones incorporated into the band design, adding color, sparkle, or symbolic detail.
How should an onyx and diamond ring be cleaned?
Clean the ring using mild soap, warm water, and a soft brush or cloth. Rinse gently and dry with a soft cloth to maintain the gemstones’ appearance.